KEGG   Staphylococcus epidermidis RP62A: SERP2288Help
Entry
SERP2288          CDS       T00229                                 

Definition
5'-nucleotidase
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2329253..2330788
Genome map
AA seq 511 aa AA seqDB search
MSQIAFYILSDVHGFIFPTDFSSREKDLPMGLLKANHLIEQDCVHYDGSVKIDNGDFLQG
SPLCNYLVSKLKSSLPLTSIYNRLGFDFGIVGNHEFNYDLPYLKQAINQLHYPVLCANII
ENTQPFTGQGIHYFKVNDLTIGTIGLTTQYIPHWEQPDYIKTLTFNSAVHTLKSELPTLR
EKSDIVVVSYHGGFERDLDSGLPTEALTGENEGYDILSQFSDSIDVLITGHQHRDIATIK
NQTAIIQPGSKGTKVGKIVIEYTHDKKVLIKECNLMNVNNNTFFKPNDEDIALRNQLEDW
LDTQIAELPYAMRINNSFEARKSPHAFVNLLNYILLEKSGADIACTALFDSANGFDEKVT
MRDIINNYPFPNTFKVIELSGKDIKLAIERSASYFDIVNHKITVNKEFLEPKPQHFNYDI
FAGIQYTIHVSHPYGERVSDLLINDAPIQSDQIYTICVNNYRAVGGGNYDMYVNKPVIKD
IQIEGAQLLIDYLSHNDLSQIPQVIDFNVVK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaattgcgttctatatccttagtgatgttcatggttttatattcccaacagat
ttttcatcaagagaaaaagatttacctatgggtttgttaaaagctaatcatctaatcgaa
caagactgcgtgcactatgacggcagtgtaaagatcgataatggggacttcttacaaggt
tctccattatgtaactacttagtatctaaattaaagagtagtctcccattaacatcaata
tataatcgtttagggtttgattttggaattgttggcaatcatgaatttaattatgattta
ccttatctaaaacaggccatcaatcaacttcattacccagttttgtgtgcaaatataatt
gaaaatacacagccattcactggccaaggtattcattattttaaagtaaatgatttaact
ataggaactattggattaaccactcagtatattcctcactgggaacaacctgattacatt
aagacactcacttttaacagtgctgttcacacattaaaatctgaattacctacacttagg
gaaaagagtgatattgtagtagtaagttatcatggtggttttgaacgtgatttagatagt
ggcctcccgactgaggcgcttactggggaaaacgaagggtatgatatactaagtcagttt
agcgatagtatcgatgtgttgataaccggccatcaacatcgtgatattgcgacaatcaag
aaccaaacagccatcattcaaccaggttcaaaaggtacaaaagttggaaaaatagttatt
gaatatacacatgataaaaaagtattaattaaagaatgtaacttaatgaatgttaataac
aataccttctttaagccgaatgacgaagatatcgctttacgtaatcaattggaagattgg
cttgatactcaaatcgcagaactcccctacgctatgagaataaacaattcatttgaggca
agaaaatcaccgcatgcatttgttaaccttcttaattatattttattagaaaaaagtggt
gcagatattgcatgtacagcactatttgattccgcaaatggctttgatgagaaagtaacc
atgcgtgatatcatcaataattatccttttcctaatacttttaaagtgattgaacttagt
ggaaaagatattaaacttgcaattgaacgaagcgcaagttattttgacattgttaatcat
aaaatcacagttaataaagagtttctagaacctaaacctcagcatttcaactatgacata
tttgcaggcatccaatatacaattcatgttagtcatccttacggtgaacgtgttagtgat
ttactaattaatgatgcaccaatacaaagtgatcaaatatatacaatatgcgtaaataat
tatagagctgttggtggcgggaattatgatatgtacgttaacaaacctgtgataaaagat
attcaaatcgaaggtgctcaattgttaatagattacttatctcacaatgatttatctcaa
atcccacaagtgattgatttcaatgttgttaagtaa

DBGET integrated database retrieval system