KEGG   Staphylococcus epidermidis RP62A: SERP2293Help
Entry
SERP2293          CDS       T00229                                 

Gene name
icaA
Definition
N-glycosyltransferase
Orthology
K11936  
biofilm PGA synthesis N-glycosyltransferase PgaC [EC:2.4.-.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     SERP2293 (icaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2334220..2335458
Genome map
AA seq 412 aa AA seqDB search
MHVFNFLLFYPIFMSIYWIVGSIYYFFIKEKPFNRSLLVKSEHQQVEGISFLLACYNESE
TVQDTLSSVLSLEYPEKEIIIINDGSSDNTAEIIYDFKKNHDFKFVDLEVNRGKANALNE
GIKQASYEYVMCLDADTVIDDDAPFYMIEDFKKNPKLGAVTGNPRIRNKSSILGKIQTIE
YASIIGCIKRSQSLAGAINTISGVFTLFKKSALKDVGYWDTDMITEDIAVSWKLHLFDYE
IKYEPRALCWMLVPETIGGLWKQRVRWAQGGHEVLLRDFWPTIKTKKLSLYILMFEQIAS
ITWVYIVLCYLSFLVITANILDYTYLKYSFSIFFFSSFTMTFINIIQFTVALFIDSRYEK
KNIVGLIFLSWYPTLYWVINAAVVIMAFPKALKRKKGGYATWSSPDRGNIQR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtatttaactttttacttttctatccaatttttatgtcaatttactggatagta
ggatcgatttactatttttttattaaagaaaaaccctttaatcgatcattgttagtaaaa
tctgaacatcaacaagttgaaggcatctcctttttattagcttgctacaatgaaagtgaa
acagttcaagacacgctttctagtgttttatctctagaatatcctgaaaaagaaattatc
attatcaatgatggaagttctgataatactgctgaaatcatctatgacttcaagaaaaat
catgattttaaatttgttgacctcgaagtcaatagaggtaaagctaatgcactcaatgag
ggaatcaaacaagcatcttacgaatatgttatgtgtttagatgctgacactgtcattgat
gacgatgcgcctttttatatgattgaagactttaaaaagaatccaaaattaggcgcagtt
acaggtaatccacgtattcgtaataaaagttctattttaggaaaaatacagaccattgaa
tatgcaagtattattggttgtatcaagcgaagtcaatctcttgcaggagcaatcaatact
atttcaggtgttttcacactatttaaaaaaagtgcactcaaagatgtaggttattgggat
actgacatgattactgaggatattgctgtttcatggaaactccatctttttgattacgaa
attaagtacgaaccacgtgctctatgctggatgttagtgcctgaaactataggtggttta
tggaaacaaagggttcgatgggctcaaggcgggcatgaagtacttttaagagacttttgg
ccaacaattaaaactaagaaattatcactatatattttaatgtttgaacaaatcgcatcg
attacatgggtctacatcgtactatgttatttatcttttttagtaatcacagccaacatc
ttagattacacatatttaaaatatagtttttcaatctttttcttttcatcctttacgatg
acctttatcaatatcatccaatttacagttgccttatttattgacagtcgctacgaaaag
aaaaatatagttggcctgatatttttaagttggtatccaacgttatactgggttatcaat
gccgcagttgtcattatggcatttcctaaagcattaaaaagaaagaaaggtggctatgct
acatggtcaagcccagacagaggcaatatccaacggtaa

DBGET integrated database retrieval system