KEGG   Staphylococcus epidermidis RP62A: SERP2293Help
Entry
SERP2293          CDS       T00229                                 

Gene name
icaA
Definition
(GenBank) intercellular adhesion protein A
  KO
K11936  poly-beta-1,6-N-acetyl-D-glucosamine synthase [EC:2.4.1.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     SERP2293 (icaA)
Glycosyltransferases [BR:ser01003]
 Polysaccharide
  Bacterial polysaccharide
   SERP2293 (icaA)
Transporters [BR:ser02000]
 Other Transporters
  Others
   SERP2293 (icaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21 Chitin_synth_2 Glyco_tranf_2_2 Glyco_tranf_2_4 Glyco_tranf_2_5 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AAW53175
UniProt: Q5HKQ0
Position
2334220..2335458
Genome map
AA seq 412 aa AA seqDB search
MHVFNFLLFYPIFMSIYWIVGSIYYFFIKEKPFNRSLLVKSEHQQVEGISFLLACYNESE
TVQDTLSSVLSLEYPEKEIIIINDGSSDNTAEIIYDFKKNHDFKFVDLEVNRGKANALNE
GIKQASYEYVMCLDADTVIDDDAPFYMIEDFKKNPKLGAVTGNPRIRNKSSILGKIQTIE
YASIIGCIKRSQSLAGAINTISGVFTLFKKSALKDVGYWDTDMITEDIAVSWKLHLFDYE
IKYEPRALCWMLVPETIGGLWKQRVRWAQGGHEVLLRDFWPTIKTKKLSLYILMFEQIAS
ITWVYIVLCYLSFLVITANILDYTYLKYSFSIFFFSSFTMTFINIIQFTVALFIDSRYEK
KNIVGLIFLSWYPTLYWVINAAVVIMAFPKALKRKKGGYATWSSPDRGNIQR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtatttaactttttacttttctatccaatttttatgtcaatttactggatagta
ggatcgatttactatttttttattaaagaaaaaccctttaatcgatcattgttagtaaaa
tctgaacatcaacaagttgaaggcatctcctttttattagcttgctacaatgaaagtgaa
acagttcaagacacgctttctagtgttttatctctagaatatcctgaaaaagaaattatc
attatcaatgatggaagttctgataatactgctgaaatcatctatgacttcaagaaaaat
catgattttaaatttgttgacctcgaagtcaatagaggtaaagctaatgcactcaatgag
ggaatcaaacaagcatcttacgaatatgttatgtgtttagatgctgacactgtcattgat
gacgatgcgcctttttatatgattgaagactttaaaaagaatccaaaattaggcgcagtt
acaggtaatccacgtattcgtaataaaagttctattttaggaaaaatacagaccattgaa
tatgcaagtattattggttgtatcaagcgaagtcaatctcttgcaggagcaatcaatact
atttcaggtgttttcacactatttaaaaaaagtgcactcaaagatgtaggttattgggat
actgacatgattactgaggatattgctgtttcatggaaactccatctttttgattacgaa
attaagtacgaaccacgtgctctatgctggatgttagtgcctgaaactataggtggttta
tggaaacaaagggttcgatgggctcaaggcgggcatgaagtacttttaagagacttttgg
ccaacaattaaaactaagaaattatcactatatattttaatgtttgaacaaatcgcatcg
attacatgggtctacatcgtactatgttatttatcttttttagtaatcacagccaacatc
ttagattacacatatttaaaatatagtttttcaatctttttcttttcatcctttacgatg
acctttatcaatatcatccaatttacagttgccttatttattgacagtcgctacgaaaag
aaaaatatagttggcctgatatttttaagttggtatccaacgttatactgggttatcaat
gccgcagttgtcattatggcatttcctaaagcattaaaaagaaagaaaggtggctatgct
acatggtcaagcccagacagaggcaatatccaacggtaa

DBGET integrated database retrieval system