KEGG   Staphylococcus epidermidis RP62A: SERP2316Help
Entry
SERP2316          CDS       T00229                                 

Definition
hypothetical protein
Orthology
K07146  
UPF0176 protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2354749..2355711
Genome map
AA seq 320 aa AA seqDB search
MDYRVLLYYKYVTIDDPETFAAEHLKFCKEHHLKGRILVSTEGINGTLSGTKEDTDKYIE
HMHADSRFADLTFKIDEAESHAFKKMHVRPRREIVALDLEEDINPREITGKYYSPKEFKA
ALEDENTVILDARNDYEYDLGHFRGAIRPDITRFRDLPEWVRNNKEQLDGKNIVTYCTGG
IRCEKFSGWLVKEGFENVGQLHGGIATYGKDPETKGLYWDGKMYVFDERISVDVNQIDKT
VIGKEHFDGTPCERYINCANPECNKQILVSEENEEKYLGACSYDCAKHERNRYVARHHIS
NEEWQRRLNNFKDVPEHTHA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggattatagagtactactttattataaatatgtaactatagatgaccctgaaactttt
gcagccgaacatttgaaattttgtaaggaacatcatttaaaaggaagaatactagtttca
acggaaggcattaatggaacattatctggaacaaaagaagatactgataaatatatagag
catatgcatgcagatagtcgttttgctgatttaacttttaaaattgatgaagctgaaagt
catgcgtttaaaaagatgcacgtgcgtccaagacgtgaaattgttgcacttgacttagaa
gaagatattaatccacgtgaaattaccggtaaatactattctcctaaagaatttaaagcc
gcactagaagatgaaaatactgttatattagatgctcgaaatgattatgaatacgattta
ggacatttccgtggagctattcgtcctgatataacacgattccgtgacttacctgaatgg
gtgcgtaataataaagaacaactcgacggaaaaaatattgtcacatattgtacaggtggc
attcgttgtgaaaaattttctggttggttagtaaaagaaggatttgaaaacgtaggtcag
ttgcatggtggtattgctacatacggtaaagaccctgaaactaaagggctatattgggat
ggtaagatgtatgtatttgatgaacgtattagtgtcgatgtgaatcaaattgataaaaca
gtcatcggcaaagagcattttgatggtacaccttgtgaacgttatattaattgtgcaaac
cctgaatgtaataaacaaattcttgtttctgaagaaaatgaagaaaaatatttaggtgca
tgttcgtatgattgtgcaaaacatgagcgcaatcgctacgttgcccgtcatcatattagc
aatgaagaatggcaacgtcgtttaaataatttcaaagatgtgcctgaacacacacatgca
taa

DBGET integrated database retrieval system