KEGG   Staphylococcus epidermidis RP62A: SERP2325Help
Entry
SERP2325          CDS       T00229                                 

Definition
acetoin dehydrogenase, E1 component, beta subunit (EC:1.1.1.-)
Orthology
K00162  
pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP2325
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP2325
   00020 Citrate cycle (TCA cycle)
    SERP2325
   00620 Pyruvate metabolism
    SERP2325
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SERP2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2361560..2362600)
Genome map
AA seq 346 aa AA seqDB search
MSEERKLTFMGAINEAIDQSMEKDEDVILIGTDVSGGAKVDHIKDDDTFGGVFGVTKGLA
KKYSRKRVIDTPIAEHITLSTAVGAAATGLRPIAELMFNDFIGFGLDPILNQGAKMRYMF
GGKAKIPLVVRTVHGAGASAAAQHSQSLYNMFAAIPGVKVVVPSNPYDAKGLLMSAIQED
NLVVFSEDKTLLGQKGNVPEEPYTIEIGKANVTREGDDLTIVAIGKMVAVAEETAEKLAE
DQVSVEVIDLRSVSPWDQETVLDSVKKTGRLIVIDESNPQCNIAGDVASVIGDVGFDYLD
GPIKKVTAPDTPVPFAANLEAAYMPNADKVLDIASELIDDLKKANA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaacgcaagttaacatttatgggggctattaatgaagctattgaccaatct
atggaaaaagatgaggatgtcattttaattggtactgatgtttcaggtggtgcaaaagta
gaccacatcaaagatgacgatacattcggtggtgtatttggtgtaacaaaaggacttgca
aaaaaatatagtcgtaaacgtgtaatcgatacaccaattgctgaacacattacattgagc
acggcagtaggagctgctgcgacagggctacgtccaattgctgaactcatgttcaacgac
tttattggatttggtttagatccaattttaaatcaaggggcaaaaatgagatatatgttt
ggtggaaaagccaaaatcccactagttgtacgtactgttcatggagcaggggcaagcgct
gctgcacagcactctcagtctttatataatatgtttgcagcaattccaggagttaaagtt
gttgttccatctaatccatatgatgcgaagggtctactgatgtcagctattcaagaggac
aatcttgttgtcttttcagaagataaaacattattaggacaaaaaggtaatgttcctgaa
gaaccttatactatagaaattggtaaagccaatgtgacgcgtgaaggtgacgatttaaca
attgtggctattggaaaaatggtagctgtagcggaagaaactgctgaaaaacttgcagaa
gaccaagtatcagttgaggtcatcgatttacgctcagtgtcaccatgggatcaagaaaca
gttttagattctgtgaagaaaacgggtcgcctaattgttattgacgaatctaatccacag
tgtaacattgctggagacgttgcttcagtgattggagatgtaggatttgattacttagat
ggtccaattaagaaagtgaccgcaccagacactcctgtaccatttgcagcgaacttagag
gcggcatatatgccgaatgctgataaggtattagacattgcatctgaattaattgatgat
ttaaaaaaggctaacgcatag

DBGET integrated database retrieval system