KEGG   Staphylococcus epidermidis RP62A: SERP2325Help
Entry
SERP2325          CDS       T00229                                 

Definition
(GenBank) acetoin dehydrogenase, E1 component, beta subunit
  KO
K21417  
acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta [EC:1.1.1.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SERP2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2361560..2362600)
Genome map
AA seq 346 aa AA seqDB search
MSEERKLTFMGAINEAIDQSMEKDEDVILIGTDVSGGAKVDHIKDDDTFGGVFGVTKGLA
KKYSRKRVIDTPIAEHITLSTAVGAAATGLRPIAELMFNDFIGFGLDPILNQGAKMRYMF
GGKAKIPLVVRTVHGAGASAAAQHSQSLYNMFAAIPGVKVVVPSNPYDAKGLLMSAIQED
NLVVFSEDKTLLGQKGNVPEEPYTIEIGKANVTREGDDLTIVAIGKMVAVAEETAEKLAE
DQVSVEVIDLRSVSPWDQETVLDSVKKTGRLIVIDESNPQCNIAGDVASVIGDVGFDYLD
GPIKKVTAPDTPVPFAANLEAAYMPNADKVLDIASELIDDLKKANA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaacgcaagttaacatttatgggggctattaatgaagctattgaccaatct
atggaaaaagatgaggatgtcattttaattggtactgatgtttcaggtggtgcaaaagta
gaccacatcaaagatgacgatacattcggtggtgtatttggtgtaacaaaaggacttgca
aaaaaatatagtcgtaaacgtgtaatcgatacaccaattgctgaacacattacattgagc
acggcagtaggagctgctgcgacagggctacgtccaattgctgaactcatgttcaacgac
tttattggatttggtttagatccaattttaaatcaaggggcaaaaatgagatatatgttt
ggtggaaaagccaaaatcccactagttgtacgtactgttcatggagcaggggcaagcgct
gctgcacagcactctcagtctttatataatatgtttgcagcaattccaggagttaaagtt
gttgttccatctaatccatatgatgcgaagggtctactgatgtcagctattcaagaggac
aatcttgttgtcttttcagaagataaaacattattaggacaaaaaggtaatgttcctgaa
gaaccttatactatagaaattggtaaagccaatgtgacgcgtgaaggtgacgatttaaca
attgtggctattggaaaaatggtagctgtagcggaagaaactgctgaaaaacttgcagaa
gaccaagtatcagttgaggtcatcgatttacgctcagtgtcaccatgggatcaagaaaca
gttttagattctgtgaagaaaacgggtcgcctaattgttattgacgaatctaatccacag
tgtaacattgctggagacgttgcttcagtgattggagatgtaggatttgattacttagat
ggtccaattaagaaagtgaccgcaccagacactcctgtaccatttgcagcgaacttagag
gcggcatatatgccgaatgctgataaggtattagacattgcatctgaattaattgatgat
ttaaaaaaggctaacgcatag

DBGET integrated database retrieval system