KEGG   Staphylococcus epidermidis RP62A: SERP2327Help
Entry
SERP2327          CDS       T00229                                 

Definition
acetoin dehydrogenase, E3 component, dihydrolipoamide dehydrogenase (EC:1.8.1.4)
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP2327
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP2327
   00020 Citrate cycle (TCA cycle)
    SERP2327
   00620 Pyruvate metabolism
    SERP2327
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP2327
   00280 Valine, leucine and isoleucine degradation
    SERP2327
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SERP2327
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SERP2327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2363666..2365018)
Genome map
AA seq 450 aa AA seqDB search
MSKSYDLIVIGAGPGGYVAAIRGAQLGKNVAVIEKNNAGGTCLNVGCIPSKTLLEHGEKA
HSIRVANDWGITTKDLKIDFTQFVQRKKKVVQTLTGGVKQLLKKNKVTYIEGEARISKNL
KVDVNNETYQAKDIILATGSQPFIPPIDGLDQVNYETTDTFFDLEKLPKQLAVIGGGVIA
TELASSMADLGVRVTIIEVADDILLTEINETREMLKAHLDNQGIKILTKAKIKQVKESKI
ILDGQDDVSFDTLLVATGRQPNTQVAKDLNLEMDGKFFKVNEHYETSQKHVYAIGDLIKG
YQLAHAASAHGIHVVETIMNKQPSLVRQEDITRCIYTRLEAASVGLSEEQAKEAGYDVKV
TQSAFQGNAKALIKGENEGFIKLVVDKKYGEVLGAFIVGPHATDIIGELLSVKASEGTIH
ELSQIIQPHPALLEAIGESADAFFDSAIHM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatcatatgacttaatcgtaataggagctggacctggtggctatgtagctgca
atacgtggtgcgcaacttggtaaaaatgttgcagtcattgaaaaaaataatgctggaggc
acgtgcttaaatgtaggttgcatcccctctaaaacgttgttagaacacggcgagaaagca
cacagcatacgagttgcaaacgattggggaatcacaacgaaagacttaaaaattgatttt
actcaatttgtccaacgaaaaaagaaagttgtacaaacacttacgggtggcgtgaagcag
ttgttaaagaaaaataaagttacttatattgaaggggaagcacgaatttctaaaaactta
aaagtggacgttaacaatgaaacgtatcaagcgaaagatataattttagcaactggcagt
cagccgttcattccaccaattgatgggttagatcaagtcaattatgaaacaaccgataca
tttttcgatttagagaagctaccaaaacagttagcggttatcggtgggggtgtgattgca
acagaactcgcatcctcaatggctgatcttggggttagagttacgataatagaagttgca
gatgacattttattaactgaaatcaacgaaactagagaaatgttaaaagcacatttagat
aatcaaggtattaagatactgacgaaagcaaagataaaacaagtaaaggaatcgaaaata
atattagatgggcaagatgatgttagctttgatacccttcttgttgcaacaggtagacaa
ccgaatacgcaagttgcaaaagatttaaatttggaaatggatggtaaattctttaaagtc
aatgaacattatgaaacgagtcaaaaacatgtctatgctataggagatttaattaaagga
tatcaacttgcacatgcagcaagtgcgcatggcattcatgttgtcgaaacaataatgaac
aaacagccgtcacttgtgcgtcaagaagatattacgcgttgtatatacacaagacttgaa
gcagcatcagttgggttatcagaagagcaagctaaagaggctggttatgatgtgaaagtg
actcaatcagcatttcaagggaatgcaaaggcgttaatcaaaggagaaaatgaaggattt
attaaacttgtcgttgataaaaagtatggagaggttcttggtgcttttattgtaggacca
catgctacagatataattggagaacttttaagtgtcaaagcatcagagggtacgattcat
gaactttctcaaattattcaaccacacccggctttattagaagcaataggtgagagtgca
gatgcattttttgattctgcaattcatatgtag

DBGET integrated database retrieval system