KEGG   Staphylococcus epidermidis RP62A: SERP2368Help
Entry
SERP2368          CDS       T00229                                 

Definition
(GenBank) peptide ABC transporter, ATP-binding protein
  KO
K10824  nickel transport system ATP-binding protein [EC:3.6.3.24]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02010  ABC transporters
Module
ser_M00440  Nickel transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP2368
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.24  nickel-transporting ATPase
     SERP2368
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    SERP2368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 SMC_N AAA_16 AAA_21 AAA_13 AAA_29 Sigma54_activat Dynamin_N DLIC MMR_HSR1 DUF87 SbcCD_C AAA_24 RsgA_GTPase NACHT FtsK_SpoIIIE AAA_33
Motif
Other DBs
NCBI-ProteinID: AAW53181
UniProt: Q5HKH7
Position
complement(2416344..2417093)
Genome map
AA seq 249 aa AA seqDB search
MLKVQNVIKFYGKKSMFRDKRIPVVKGVSFDCPTGASVAIIGESGSGKSTLSRMILGLEK
PDQGQVTLDGQPVHLKKVRRHRIAAVFQDYTSSLHPFHTVKDILFEVMNQCRCTSKENME
EYVTVLLREVGLKSDCLYCYPHMLSGGEAQRVAIARAICMQPDYILFDEAISSLDMSMQT
QILDLLKRLRHSHQLSYIFITHDIQAATYICDDLLIFKNGCIEARTSISELHRQQNGYTR
ELIDKQLSI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaggttcaaaatgttattaaattttatggaaaaaaatcaatgtttcgtgataaa
cgtattcctgtagttaaaggcgtgtcatttgattgtcccactggtgcatcagtagcaatt
attggtgaaagtggaagtggaaagtctacgttgagtcgtatgattttaggactagaaaaa
ccagatcaaggacaagtgactttggacggtcagcctgttcatttaaaaaaagtgagacgt
catcgaattgctgcggtttttcaagactatacttcttctttgcatccttttcatactgtc
aaagatattttgtttgaagtaatgaatcaatgtcgatgtacatcgaaggagaatatggaa
gagtatgtaacagtgttactacgtgaagtagggttaaaatctgattgtttgtattgttat
ccacatatgctttcaggtggagaagcacagcgtgtagctattgcacgtgcgatatgtatg
caaccagattatatattatttgatgaggcgattagttcattagatatgtctatgcaaaca
caaatattagatttattgaaaaggttacgtcactcacaccagctgagttatatctttatt
actcatgatatacaagctgcgacatatatatgtgatgacttgcttatttttaaaaatggt
tgtatcgaagctaggacatctataagtgaattgcataggcaacaaaatggttatacaaga
gaactgattgataaacaactatcaatctaa

DBGET integrated database retrieval system