KEGG   Staphylococcus epidermidis RP62A: SERP2371Help
Entry
SERP2371          CDS       T00229                                 

Definition
peptide ABC transporter permease
Orthology
K15585  
nickel transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Nickel transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2418763..2419698)
Genome map
AA seq 311 aa AA seqDB search
MVKFIMKRLTLMIPLLIVVTFMTFMMTYLTNEDPAVTILHAQGTPNITQDLIAETKEKYG
LNQPIFTQYKNWLVDALQFKFGTSYITGDPVSERMGPAFMNTLKLTLISSVVVMITSVVL
GIVSALTSGRFTDRAIRSIAFLLTALPSYWVASILIIYVSVKLNLLPTSGLTGPESYILP
VFVITITYAGIYFRNVRRSMLEQLNEDYVLYLKASGVPRLTMLLHVLRNALQVAISIFCM
SIPMIMGGLVVIENVFAWPGLGPLSIKAITEHDFPVIQAYVLIVAVLFILFNTLADIINA
ILNPRLREAMK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggttaaatttattatgaaacgtcttactctcatgattccattattgattgtagtgact
tttatgactttcatgatgacctatctcacgaacgaagatccagccgtaacaattttacat
gcccaaggaacgcctaatataacgcaagatttaatagctgaaactaaagaaaaatatgga
ttaaatcaaccgatattcacgcaatataaaaattggcttgttgatgccttgcagtttaaa
tttggaacgagttatatcacaggggatccagtatctgagcgtatggggccagcgtttatg
aatacattaaaactcactttgatttccagtgttgtggtaatgataacgtctgttgtacta
ggcatagtgagtgctttgactagtggtagatttacagatcgtgctatacgttcaatagct
tttctactaacagctctgccctcatattgggtagcttcaatattaattatttatgtatct
gtaaaactcaatttattaccaacctcaggactcactggtccagaaagttatattcttcca
gtctttgttattacgattacctatgcaggaatttattttagaaatgtccgacgatctatg
cttgaacaattaaatgaagattatgttttgtatttaaaagctagtggtgtacctcgtctg
acaatgttgctgcatgtattacgtaatgcattacaggtagccatatctattttttgtatg
tcgataccaatgattatgggaggtctagtcgttattgaaaatgtatttgcgtggccgggt
ttaggaccattaagtattaaagcgattactgaacatgattttccagtaattcaagcatac
gtgctcattgtcgcggtgttgtttattctttttaatacacttgcagacatcattaatgca
atattaaatccgcgtttaagggaggcaatgaaatga

DBGET integrated database retrieval system