KEGG   Staphylococcus epidermidis RP62A: SERP2378Help
Entry
SERP2378          CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
ser_M00254  ABC-2 type transport system
Brite
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    SERP2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 RsgA_GTPase AAA_29 AAA_15 AAA_22 AAA_13 NB-ARC DLIC AAA_27 AAA_16 Glyco_hydro_1 AAA_30 G-alpha NACHT AAA_5 AAA_14 PhoH Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AAW53205
UniProt: Q5HKG7
Position
2424945..2425634
Genome map
AA seq 229 aa AA seqDB search
MIDIQNVSKSYKKKHIFDSLDMQFQNHKITILLGENGAGKSTLLRLIAGIENADEGRIQY
FNQYLSRRRIRHIVGYVPQDIALFEHMTVMENIEFFKSLCENPISDETLHSYLSQLNFTD
TKVKVSNLSGGNKRKVNIMIGLLSRPKILILDEPTEGIDLESRYDIHNLLQQMTDQCLII
MTTHHLDEVEALADDIKVIGQNPFYHDILENKGWSFKKYANALADNTKS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatagatattcaaaatgtttccaaaagctataaaaagaagcatattttcgattcccta
gatatgcaatttcaaaatcataaaattactattttattaggtgaaaatggtgctggaaaa
tctacattattgcgtttaattgcaggtattgagaatgcagacgaaggacgtattcaatac
ttcaatcaatatttgtcaagacgtcgaatacgtcatattgtaggctatgtccctcaagac
atcgcactattcgagcatatgactgtcatggagaacattgagtttttcaagtcactttgt
gaaaatcctatttcagatgaaacacttcattcttatttatcacaattaaactttactgat
acaaaagtgaaagtatctaacctttctgggggaaataaacgtaaagtcaatattatgata
ggtctacttagtcggcctaaaatacttattctagatgagccaacagaaggcattgattta
gaatcaagatatgatattcacaacttattacaacaaatgaccgatcaatgtttaatcatc
atgacgacacatcatttagacgaagttgaagcattagcagatgatattaaagttataggt
caaaatcctttttatcatgatattttagaaaataaaggttggtcttttaaaaaatatgca
aatgccttagctgataatacgaaatcttaa

DBGET integrated database retrieval system