KEGG   Staphylococcus epidermidis RP62A: SERP2401Help
Entry
SERP2401          CDS       T00229                                 

Definition
serine protease
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2462460..2463194)
Genome map
AA seq 244 aa AA seqDB search
MEDHNASAAYHKAKKVDNSQIVIKRYNYAHKNKYKAVGRVSNMDGWKGPGKDSMGTGFMV
GNHTFVTNAHVVDKKNGQRTSPSKIKFQLNRDGKKIPYQFHAKKIYKIPSYDMVVVETKE
NMAQKANVQPLKLATNQKIKSLKFNKKLYSLGYPVMNGNNTYAYWNKLRFLQEASNKSEL
MTKDKFRAGDSGSPMVDSQYVVYGVRTYGYNLRGSSNHPYAQQEVAGAESLYGNPRDFIL
KHNK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaagatcataatgcgagtgctgcatatcataaagcgaagaaagttgataatagtcaa
atagtcataaaacgttataactatgcgcataaaaataaatataaagcagtaggaagagta
tcgaacatggatggctggaaaggtccaggcaaagatagtatgggaacaggatttatggta
ggcaatcatacgtttgtaaccaatgcacatgttgtagataagaaaaatggtcaaagaacg
agtccgagtaaaataaaatttcaattaaacagagacggtaaaaagataccctatcaattt
catgctaaaaagatatataaaatcccttcatacgatatggttgtcgttgaaactaaagaa
aatatggctcaaaaagctaacgtgcaaccacttaaacttgcaaccaatcaaaaaattaag
agtttaaaatttaacaagaaattatattctttaggatatccagtgatgaacggaaacaat
acatatgcatactggaataagttacgttttttacaagaagcatcgaataaatcagaactc
atgacaaaagataaatttagagctggtgattcaggatctcctatggtagatagccagtac
gttgtttatggggttcgtacgtatggatataatttaagaggtagttctaatcatccttat
gcccaacaagaagtggcaggtgcagaatcattatatggtaatccaagagattttattctt
aagcataataagtaa

DBGET integrated database retrieval system