KEGG   Staphylococcus epidermidis RP62A: SERP2406Help
Entry
SERP2406          CDS       T00229                                 

Definition
AraC family transcriptional regulator
Orthology
K07720  
two-component system, response regulator YesN
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ser02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2466930..2467685
Genome map
AA seq 251 aa AA seqDB search
MFKVIICDDERIIREGLKQMVPWEDYHFTTVYTAKDGVEALSLIRQHQPELVITDIRMPR
KNGVDLLDDIKDLDCQIIILSSYDDFEYMKAGIQHHVLDYLLKPVDHTQLEHILDILVQR
LLERPHSTNDDAAYHTAFQPLLKIDYDDYYVNQILSQIKQHYHKKVTVLDLINPIDVSES
YAMRTFKEHVGITIVDYLNRYRILKSLHLLDQHYKHYEIAEKVGFSEYKMFCYHFKKYLH
MSPSDYNKQSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagttattatttgcgatgatgaaaggattataagagaaggcttaaagcaaatg
gttccatgggaggactatcatttcaccactgtttatactgccaaagacggcgtggaagca
ttgtctttaattcgccaacatcaacctgaactcgtcattactgatatacgaatgcctcga
aaaaatggtgttgacctactagatgacatcaaagaccttgattgccagattatcatttta
tcgagttatgacgacttcgaatatatgaaagccggtatacaacatcatgttcttgattat
ttactaaagccagtagaccacactcagttagagcatattctagacatattagttcaaagg
ttattagaacgcccacattctaccaatgatgacgcggcatatcatactgcctttcaacca
ttattaaaaattgattacgatgactattatgtcaatcaaattttgtctcaaatcaagcaa
cattatcacaagaaagtgactgttcttgacttaattaatcctattgatgtaagtgagtca
tacgccatgaggacgtttaaagaacatgtaggcattacgatagttgattatctaaatcgt
tatcgtattttaaaatcattacatcttttagaccagcactacaagcattatgaaattgct
gaaaaagtaggtttttctgagtataaaatgttttgctatcattttaaaaaatatttacat
atgtcaccaagtgattataataagcaatcaaaatag

DBGET integrated database retrieval system