KEGG   Staphylococcus epidermidis RP62A: SERP2406Help
Entry
SERP2406          CDS       T00229                                 

Definition
(GenBank) DNA-binding response regulator, AraC family
  KO
K07720  two-component system, response regulator YesN
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP2406
Two-component system [BR:ser02022]
 Other families
  YesM-YesN [MD:M00519]
   SERP2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AAW53253
UniProt: Q5HKE0
Position
2466930..2467685
Genome map
AA seq 251 aa AA seqDB search
MFKVIICDDERIIREGLKQMVPWEDYHFTTVYTAKDGVEALSLIRQHQPELVITDIRMPR
KNGVDLLDDIKDLDCQIIILSSYDDFEYMKAGIQHHVLDYLLKPVDHTQLEHILDILVQR
LLERPHSTNDDAAYHTAFQPLLKIDYDDYYVNQILSQIKQHYHKKVTVLDLINPIDVSES
YAMRTFKEHVGITIVDYLNRYRILKSLHLLDQHYKHYEIAEKVGFSEYKMFCYHFKKYLH
MSPSDYNKQSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagttattatttgcgatgatgaaaggattataagagaaggcttaaagcaaatg
gttccatgggaggactatcatttcaccactgtttatactgccaaagacggcgtggaagca
ttgtctttaattcgccaacatcaacctgaactcgtcattactgatatacgaatgcctcga
aaaaatggtgttgacctactagatgacatcaaagaccttgattgccagattatcatttta
tcgagttatgacgacttcgaatatatgaaagccggtatacaacatcatgttcttgattat
ttactaaagccagtagaccacactcagttagagcatattctagacatattagttcaaagg
ttattagaacgcccacattctaccaatgatgacgcggcatatcatactgcctttcaacca
ttattaaaaattgattacgatgactattatgtcaatcaaattttgtctcaaatcaagcaa
cattatcacaagaaagtgactgttcttgacttaattaatcctattgatgtaagtgagtca
tacgccatgaggacgtttaaagaacatgtaggcattacgatagttgattatctaaatcgt
tatcgtattttaaaatcattacatcttttagaccagcactacaagcattatgaaattgct
gaaaaagtaggtttttctgagtataaaatgttttgctatcattttaaaaaatatttacat
atgtcaccaagtgattataataagcaatcaaaatag

DBGET integrated database retrieval system