KEGG   Staphylococcus epidermidis RP62A: SERP2423Help
Entry
SERP2423          CDS       T00229                                 

Definition
lipoprotein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2482536..2483315)
Genome map
AA seq 259 aa AA seqDB search
MKHSSKIIVFVSFLILTIFIGGCGFINKEDSKEAEIKQNFNKTLSMYPTKNLEDFYDKEG
YRDEEFDKDDKGTWIINSKMIVEPKGEEMEARGMVLRINRNTRTAKGNFIIKRITENNKG
IPDVKDKKYPVKMEHNKIIPTKQIKDKKLKKEIENFKFFVQYGNFKNLKDYKDGEISYNP
NVPSYSAQYQLNNYDNNVKQLRKRYDIPTNQAPKLLLKGTGDLKGSSVGYKHLEFTFVEN
KKENIYFTDSINFNPSRGN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattcaagcaaaataatagtatttgtaagtttcttaattttaacgatttttatt
ggaggatgtggttttataaataaagaagatagcaaagaagctgaaatcaaacaaaacttt
aataaaacgttaagtatgtatccaactaaaaatctagaagacttttatgataaagagggc
tatcgtgatgaagagtttgacaaagatgacaaagggacatggattattaattctaaaatg
attgttgaaccgaaaggggaagagatggaagcaagagggatggttttacgtataaataga
aatacgagaacagctaaaggtaactttattataaaacgaataacagaaaataataaagga
atacctgatgttaaagacaaaaaatatccagtaaaaatggaacacaataaaattattcca
acaaaacaaattaaagataaaaaattaaaaaaagaaattgagaacttcaaattttttgta
caatatggaaattttaaaaacttaaaggattataaagacggagagatatcttacaatcct
aatgtgccaagttactcagcgcaatatcaattgaacaattatgataataatgttaaacaa
ctaagaaaaagatatgatattcccacgaatcaagctcctaaattattattgaaaggtaca
ggagatttaaaaggatcctctgtaggttataaacatcttgaatttacttttgtagaaaat
aaaaaggaaaatatttattttactgacagtataaactttaacccgagtagggggaattaa

DBGET integrated database retrieval system