KEGG   Staphylococcus epidermidis RP62A: SERP2433Help
Entry
SERP2433          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trns_repr_metal TcdB_N Laminin_I
Motif
Other DBs
NCBI-ProteinID: AAW53290
UniProt: Q5HKB5
Position
complement(2490569..2490829)
Genome map
AA seq 86 aa AA seqDB search
MEYNKKMINRIHRIQGQLNGVIKMMEEEKNCKDVISQLSASKSSIQRLMGIIISENLVEC
VKMSEENSEDSQALINEAVELLIKSK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
ttggaatataataaaaagatgattaatcgtattcatcgcatacaaggacaacttaatggt
gtcattaaaatgatggaggaagaaaaaaattgtaaagatgtcattagtcaattaagtgcc
tctaaaagttctattcaacgtttaatgggtattatcattagcgagaacttagtagaatgc
gtcaaaatgtctgaagaaaatagtgaagattctcaggcattaattaatgaagcagttgaa
ttattaataaaaagtaaatga

DBGET integrated database retrieval system