KEGG   Staphylococcus epidermidis RP62A: SERP2445Help
Entry
SERP2445          CDS       T00229                                 

Definition
lipoprotein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2500712..2501497)
Genome map
AA seq 261 aa AA seqDB search
MKHSKKLLLCISFLLITFFIGGCGFMNKDDGKETEIKQNFNKMLNVYPTKNLENFYDKEG
YRDEEFDKDDKGTWIVHSKMVIEPKGKNMESRGMVLFINRNTRTSKGYFIVNEIEKDRKG
RPINNKKKYPVKMKNNKIIPTKPISNDKLKKEIENFKFFVQYGNFKDIKNYKDGDISYNP
NVPSYSAKYQLSNNEYNVQQLRKRYDIPTKKVPKLLLKGDGDLKGSSVGSKNLEFTFIEN
KEENIYFTDSVLFSPSEDNES
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacattcgaaaaagttacttttatgcatcagttttttattaataacgttttttatt
ggtggatgtggatttatgaataaagacgatggtaaagaaacggaaatcaaacaaaacttt
aataaaatgttaaacgtgtatcccactaaaaatctagaaaacttttatgataaagagggc
tatcgagatgaagagtttgataaggatgacaaaggaacatggatagttcattctaaaatg
gttattgaaccaaaaggcaaaaacatggaatctagagggatggttctctttatcaatcgc
aatactagaacatcaaaaggctattttatagtcaatgaaatagaaaaggatagaaaagga
agacccattaataataaaaagaaatatcctgtaaaaatgaaaaataataaaattattcca
accaaaccaatatctaatgataaattaaaaaaagaaattgaaaactttaaattttttgta
caatatggcaattttaaagatattaaaaattataaagatggtgacatttcatacaatcct
aatgtacctagttattctgcaaaatatcaattgagtaataatgaatataacgtacaacaa
ttaagaaaaagatatgacatcccaactaaaaaagtacctaaactattgttgaaaggtgat
ggggatttaaaaggttcatccgtaggttctaaaaatctagaatttacttttatagaaaat
aaagaagagaatatctattttacagattctgtactatttagccctagcgaggataatgaa
tcatga

DBGET integrated database retrieval system