KEGG   Staphylococcus epidermidis RP62A: SERP2452Help
Entry
SERP2452          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2505920..2506105)
Genome map
AA seq 61 aa AA seqDB search
MSSAEYKIKSKSMTNYSEETSSISNISYEIENANNNVLPRNRIMAQTEKLKDDNKFPSNL
E
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagctgaatataaaataaaatcgaaaagtatgactaattattcagaagaaact
agttcaatttcgaatattagttatgaaatagaaaatgccaataataatgttttacctaga
aatagaattatggcccaaactgagaagttgaaagacgataataaatttccttctaacctt
gaatag

DBGET integrated database retrieval system