KEGG   Staphylococcus epidermidis RP62A: SERP2491Help
Entry
SERP2491          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2550930..2551832
Genome map
AA seq 300 aa AA seqDB search
MGSTFSTINPFSVVIASNAAGTTFTDGLYWRIGACIIGAIFVISYLFWYCKKIKKDPKSS
YSYEDKAAFEKQWSVLHDDGSSEFTLRKKIILTLFVLPFPIMVWGVMTQGWWFPVMASAF
LIFTIVIMFIAGTGQYGLGEKGTVDAFVNGASSLVGVSLIIGLARGINLVLNKGMISDTI
LHFSSSIVQHMSGPLFIIVLLFIFFCLGFIVPSSSGLAVLSMPIFAPLADTVGIPRFVIV
TTYQFGQYAMLFLAPTGLVMATLQMLNVRYSHWLRFVWPVVAFVLIFGGGLLITQVLIYS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgggtagtacattctcaacaatcaacccattctcagtcgtcattgcttctaatgcagca
ggaacaacttttactgatggtctttattggagaataggcgcttgtatcatcggtgccata
tttgttattagttatttattctggtattgtaaaaaaattaaaaaagatcctaaatcctct
tattcttatgaagacaaagcagcatttgaaaaacagtggtctgtgctccatgatgacggt
tcttctgagtttacattacgtaaaaagattattcttacgcttttcgtcctaccattccct
attatggtttggggtgttatgacacaaggatggtggttcccagtcatggcatctgcattc
ttaatctttaccattgtcatcatgtttattgctggaacaggacaatatggtttaggcgaa
aaaggcactgtagatgcattcgttaatggcgcttcaagtttagtaggtgtatctttaatc
attggtttagctcgtggaatcaacttagtattgaataaaggaatgatttctgacacaatc
ttgcacttttcatcatctatcgtgcaacatatgagtgggcctttatttatcattgttctg
ctctttatctttttctgtttaggatttatcgtaccatcatcatcaggattagcagtatta
tctatgcctatctttgcgccattagctgatacagtaggtataccaagatttgttattgtt
acaacatatcaattcggtcagtatgcaatgttgttcttagcgcctactggacttgtaatg
gcaacacttcaaatgttaaacgtgcgctactcacactggttacgtttcgtatggcctgtt
gtcgcgtttgttttaatatttggtggaggcttactcattacacaagttttaatatattct
taa

DBGET integrated database retrieval system