KEGG   Staphylococcus epidermidis RP62A: SERP0052Help
Entry
SERP0052          CDS       T00229                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00010  Glycolysis / Gluconeogenesis
ser00260  Glycine, serine and threonine metabolism
ser00680  Methane metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01200  Carbon metabolism
ser01230  Biosynthesis of amino acids
Module
ser_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ser_M00002  Glycolysis, core module involving three-carbon compounds
ser_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP0052
  Energy metabolism
   00680 Methane metabolism
    SERP0052
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP0052
Enzymes [BR:ser01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SERP0052
Membrane trafficking [BR:ser04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SERP0052
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SERP0052
  Exosomal proteins of melanoma cells
   SERP0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAW53444
UniProt: Q5HRY8
Position
43843..44433
Genome map
AA seq 196 aa AA seqDB search
MEIYLVRHGESQSNYDNKHGYLYFCGQLDVPLTERGIKSAKELSVYFKNKYIDNVYVSDL
KRTRQTYEELFPYDIPTIYTKTLRERSLGVFEGKNKEEVCKDKRFEKYFRDPNYKYFRHS
FSQKAPQGESYQDVYDRVVTFIENELNQQQRRVVIVAHQVVIRCFFVYFKMITKEEALTT
EIHNCYPYLIKEEMKF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatttagtgaggcatggtgagtcacagtccaattatgataataaacacggg
tatctatatttttgtggacagttagacgtccctttgacggaaaggggtataaaaagcgct
aaagaactatctgtttattttaaaaataaatacattgacaatgtatatgtatcagattta
aaaagaacaaggcaaacgtatgaggagctatttccttatgatattccaacaatatataca
aagacgttaagagagcgttcgttaggtgtttttgaaggtaaaaataaagaagaagtttgt
aaagacaaacggttcgaaaaatatttccgtgatcctaattataaatactttagacatagc
ttttcgcaaaaagcaccacaaggagaaagttatcaagatgtctatgatagagtggttact
ttcattgaaaatgagcttaatcaacagcagagacgtgtagtgatagttgcgcaccaagtt
gtaattagatgttttttcgtctattttaaaatgataactaaggaagaagccttaacgacg
gaaattcataattgctatccatatttaattaaagaagaaatgaagttttga

DBGET integrated database retrieval system