KEGG   Staphylococcus epidermidis RP62A: SERP0090Help
Entry
SERP0090          CDS       T00229                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
76026..76754
Genome map
AA seq 242 aa AA seqDB search
MKVKSPQSIYLKGHRQQAVLLLHSFTGTVRDVKHLAQQLNEEGFTCYVPSYPGHGLPLKE
FTQHNINDWWEQVTAAYQFLRNAGYSRINVTGVSLGGLFTLRLAEHFDLERIAVMSAPHK
KRESEIAWRLERYGHRMNEILSLSEEERRHQMETILSYDKEIEVFQGVIDEIMAYLANIT
VPVNIMYGEEDDPLYAQSAQYIYDNVNSQDKELLKFEKSGHLMTYGDHAYRVEQSIIQFF
SK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaatcaccacaatcaatctacttaaaaggacatcgtcaacaagctgtattg
ttattacattcttttacgggaactgtacgtgatgtaaaacatttagcacaacagttgaat
gaagagggatttacttgttacgtgcctagttatccaggccacggtttgccacttaaggaa
tttacccaacacaatattaatgattggtgggaacaagttacagcagcatatcaattttta
agaaatgcaggatacagtagaattaatgtgacaggcgtatcattaggcggattatttact
ttaaggttagctgaacattttgatttagaacgtatagctgtgatgtcagccccacataaa
aagcgtgaaagcgagattgcgtggcgtcttgaaaggtatgggcatcgaatgaatgaaatt
ttgagtttaagcgaagaagagcgtcgtcaccaaatggaaaccatcttgtcttatgataaa
gaaattgaagtgtttcaaggtgtaattgatgaaattatggcttatcttgcaaatattaca
gtaccagtgaatattatgtatggcgaagaagatgacccattatatgctcaaagtgcgcaa
tacatttatgataatgtaaatagtcaagataaagaactgctcaaatttgaaaaaagcggt
catcttatgacgtatggcgatcatgcatacagagtagaacaatctattattcaatttttc
agtaaataa

DBGET integrated database retrieval system