KEGG   Staphylococcus epidermidis RP62A: SERP0153Help
Entry
SERP0153          CDS       T00229                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SERP0153 (folP)
Enzymes [BR:ser01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SERP0153 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
145475..146293
Genome map
AA seq 272 aa AA seqDB search
MIKTKIMGILNVTPDSFSDGGQYHSVDQAVKRAKEMIDEGVDIIDVGGVSTRPGHKEVSH
KEVSLKEEMNRVLPVVESIVKYDVQISVDTFRSEVAEACLKLGVSMINDQWAGLFDSNMF
NVVSQYGAEIVLMHNGDGHRDKPVVEEMLVSLLAQANKAELAGIPHNKIWLDPGIGFAKT
REEENEVMARLDELVATEYPVLLATSRKRYIKEMMNQDSSPSDRDEATAATTAYGIMKGV
RGVRVHNVLLNTRLAQSMDFLKENEYERHHLS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacaaaaataatggggatattaaatgtgacacctgactcattttctgacgga
ggacagtaccactcagttgatcaagctgtgaagcgtgctaaagagatgatagatgaaggt
gtagacatcatagacgttggaggtgtctcaacacgaccaggtcataaagaagtatcgcat
aaagaagtatcgcttaaagaagaaatgaatcgtgtattgcctgtggttgagtctatcgtt
aaatatgatgtgcaaatttcggttgatacatttcgaagtgaagttgcggaagcttgtctt
aaacttggtgtttcaatgattaatgatcagtgggcaggcctatttgattcgaatatgttt
aatgtggtatctcaatacggtgctgaaattgtacttatgcataatggtgacggtcataga
gataaacctgttgttgaagagatgcttgtatcattacttgcgcaagcgaataaggctgaa
ctagccggtataccacataataaaatctggttagatcctggaataggttttgctaaaaca
cgagaagaagaaaatgaagtaatggcaagattagatgaattagtagcgaccgaatatcca
gttttacttgcaacaagtcgaaaaagatacattaaagaaatgatgaatcaagattcttct
ccttcagatagagatgaggcaactgcagctacaacggcttatggtataatgaaaggcgtt
cgtggggttcgagttcataatgtattattaaatacgcgactagcccaaagtatggatttt
ctaaaggagaatgaatatgaacgacatcatctttcttaa

DBGET integrated database retrieval system