KEGG   Staphylococcus epidermidis RP62A: SERP0220Help
Entry
SERP0220          CDS       T00229                                 

Definition
(GenBank) acetyl-CoA acetyltransferase, putative
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00071  Fatty acid degradation
ser00072  Synthesis and degradation of ketone bodies
ser00280  Valine, leucine and isoleucine degradation
ser00310  Lysine degradation
ser00362  Benzoate degradation
ser00380  Tryptophan metabolism
ser00620  Pyruvate metabolism
ser00630  Glyoxylate and dicarboxylate metabolism
ser00640  Propanoate metabolism
ser00650  Butanoate metabolism
ser00900  Terpenoid backbone biosynthesis
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01200  Carbon metabolism
ser01212  Fatty acid metabolism
ser02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SERP0220
   00630 Glyoxylate and dicarboxylate metabolism
    SERP0220
   00640 Propanoate metabolism
    SERP0220
   00650 Butanoate metabolism
    SERP0220
  Lipid metabolism
   00071 Fatty acid degradation
    SERP0220
   00072 Synthesis and degradation of ketone bodies
    SERP0220
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SERP0220
   00310 Lysine degradation
    SERP0220
   00380 Tryptophan metabolism
    SERP0220
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SERP0220
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SERP0220
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP0220
Enzymes [BR:ser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SERP0220
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SERP0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAW53600
UniProt: Q5HRH3
Position
230043..231191
Genome map
AA seq 382 aa AA seqDB search
MKQPVIIAAKRIAFGKYGGRLKHLEPESLLEPLFNHFTDQYPKVMSLLDDVILGNTVGNG
GNLARKSLLEAGLDFKIPGITIDRQCGSGLEAVIQACRMVQSGAGTIYIAGGVESTSRAP
WKIKRPQSVYESEFPQFFERAPFAREGEDPSMIEAAENVAKKYHISRNEQDDFAYRSHQL
ASKNMNNGNISQEILPFKVKGECFNQDESIKPQLTLKTLGRLKPLLNEGTVTVGNSCMKN
DGAVLLIVMEENRARQLGFTEGIKFVNSATVGVQPQYLGVGPVPAVNQLLARERLTINDI
NAVELNEAFSSQVIASQQQLNIPLNKLNCWGGAIATGHPYGASGAALVTRLFYMKHQFRT
VATMGIGGGIGNAALFERWYGN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacctgttattattgcagcaaaacgtatagccttcggtaagtatggtggccga
ttgaagcatttagaacctgaatcattactagaacctttatttaatcattttacagatcag
tatccaaaagtaatgtctcttttggatgacgtcattttaggtaatacggtaggtaatggt
ggtaatttagctagaaaatcattactcgaagcaggattagattttaaaatacctggtata
acaattgatcgtcaatgtggttcaggtcttgaagctgttatacaagcttgtaggatggta
caaagtggtgctggaacaatatatattgcaggtggtgttgagagtactagtagagctcct
tggaaaatcaaacgcccgcagtcagtttatgaatctgagtttccacaattttttgaacgg
gcgccttttgcaagagaaggagaagacccttcaatgattgaagccgctgaaaatgtagcg
aaaaaatatcacatcagtagaaatgaacaagatgactttgcttatcgcagtcatcagttg
gcatcaaaaaacatgaataacggtaatatttcccaagaaattttaccgttcaaagtgaaa
ggtgaatgttttaatcaagatgaaagtattaaacctcaactcactctcaaaacacttggc
agacttaaaccgcttttaaatgaaggaacagtcacagtaggaaacagttgtatgaaaaat
gatggtgcagtattactgattgttatggaagaaaatcgggcacgtcaattaggattcacc
gaagggattaagtttgtaaatagtgctactgtaggtgttcaacctcagtatttaggagtg
ggtccagtgccagcagtaaatcaattattagctcgggaacgattaactataaatgatata
aatgcagtagaattaaatgaagcatttagctctcaagttattgctagccaacaacaactt
aacatacctttgaataagttgaattgttggggtggagcaattgctacagggcatccatat
ggtgcaagtggagcagcgttagtcacacgtttattttatatgaaacatcaatttagaact
gtagcaactatgggaataggtggaggaataggaaatgcagctttatttgaaagatggtat
ggaaattag

DBGET integrated database retrieval system