KEGG   Staphylococcus epidermidis RP62A: SERP0223Help
Entry
SERP0223          CDS       T00229                                 

Definition
major facilitator family transporter
Orthology
K03762  
MFS transporter, MHS family, proline/betaine transporter
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231998..233392
Genome map
AA seq 464 aa AA seqDB search
MVDGNNAKKTVIATGIGNAMEWFDFGLYSYLAVIISKNFFSQVDNDQLKLVFTFATFAIA
FLLRPIGGIVFGIIGDKYGRKIVLTTTIILMAFSTLLIGVLPTYNEIGVWAPILLLLARV
LQGFSTGGEYAGAMVYVAESSPDRKRNSLGCGLEIGTLSGYIAASILVFALNISLTETQL
NSWGWRIPFLLGMFLGLFGLYLRRKLEESPIYENEQRELQKHPTREPIGVFTLIRFYYKD
IIVCFVAVAFFNVTNYMVTAYLPSYLEGVIKLNGTTTSIMITCIMVIMIPLALMFGRIAD
RIGEKKVFLIGLGGLILLSVVAFSLMQLQSLFFVSIGVLILGFFLSTYEATMPGSLPTMF
YTHVRYRALAITFNVSVSLLGGTTPLIASYLVSTTNNPLTPAYYLTVISIIGFIVIALLH
KSTASKSLKGSYPNVDNEKDREYYEKNPEQALWWLKERQEKEKF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggttgacggtaataatgccaaaaaaacagttattgccactggaataggtaacgctatg
gagtggtttgattttggtttatactcatatttagcagtaataataagtaaaaactttttt
agtcaagttgataatgatcaactaaagttagtttttacatttgctacatttgctatagca
tttttattacgccctataggtggtattgtttttggtatcattggagataaatacggtcgt
aaaatagtattaactacaacaatcatattaatggccttttccacgctattaataggcgtt
ttgcctacatataatgaaataggagtatgggcgccaatattattacttttagctagagtc
ctacaaggattttctactggaggagaatatgcaggagcaatggtttatgttgctgagtca
tcaccagatagaaaaagaaattctcttggttgtggactggaaattggaacattatcagga
tatatagctgcgtcaattttagtatttgctttaaatatctctttaactgaaacacaactg
aattcatggggatggagaattccttttttattgggaatgttcctaggtctttttggatta
tatttgcgtcgtaaattagaggaatcaccaatatatgaaaacgaacaaagggaattacaa
aagcatcccacaagagagcctatcggggtatttactttaattagattttactataaagat
attatagtatgttttgttgcagtagcattctttaatgttactaattacatggttactgct
tatctgccatcatatttagaaggtgtaattaaattaaatggaacaactactagtatcatg
attacttgtattatggttataatgattccattggcactaatgtttggacgtatagccgat
agaattggggagaaaaaagtatttcttatcggtttaggtggattaatattattaagtgtt
gtggctttctcattgatgcaattacaatcgttattctttgtatcaataggtgtattaata
ctaggtttctttttatcaacttacgaagcaacgatgcctggttcacttccaacgatgttt
tatacacatgtacgttatcgtgccttagctattacttttaatgtttctgtttctttactt
ggaggtactacgccattgatagcatcatatttagttagtactactaataatccattaaca
ccagcatattatttaacagtaataagtataataggtttcatagtcatagcattattgcac
aaaagtaccgcaagtaagtcattaaaaggatcttaccctaatgttgataatgaaaaggat
agagagtattatgaaaaaaatcctgaacaggcattatggtggttaaaggaaagacaggaa
aaagaaaaattctaa

DBGET integrated database retrieval system