KEGG   Staphylococcus epidermidis RP62A: SERP0257Help
Entry
SERP0257          CDS       T00229                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SERP0257 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP0257 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SERP0257 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SERP0257 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SERP0257 (adhA)
   00626 Naphthalene degradation
    SERP0257 (adhA)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SERP0257 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265167..266189
Genome map
AA seq 340 aa AA seqDB search
MKAAVVTKDHRVSIEEKRLRELKPGEALVKTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGRVIEVADNVDSLKVGDRVSIAWMYAACGNCEYCTTGRETLCRDVLNAGYTVDGAMAEE
VIVDANYAVKVPENLDPAAASSITCAGVTTYKAVKVSGIEPGQWLGVFGVGGLGNLALQY
AKNVMGAKVVAFDINDDKLNFAKELGADAIINSTNVDPIEEVNRLTNNKGLDATVITAVA
KTPFNQAVDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIEVVGSLVGTRQDLREAFQFAA
ENKVIPKVQLRQLSEINDIFDEMEKGTITGRMVIDMKSSH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtagtaaccaaagatcacagagtaagtattgaagaaaaacgtttaaga
gaattaaaacctggagaagcattagtaaagactgaatattgtggtgtatgtcacactgat
ttacatgttaaaaatgcagatttcggtgacgtaacaggtgtaacgctaggacatgaggga
attggacgtgtcattgaagttgctgataacgtagattcattaaaggtaggggatcgtgta
tctatagcatggatgtatgcagcatgcggtaattgtgagtattgcacaactggtagagaa
acattatgcagggatgttcttaatgccggatatactgttgacggggcaatggctgaagaa
gtcattgttgatgcgaattatgcagttaaagttcccgaaaatcttgatccagcggctgct
tcatctattacctgtgcaggtgtgacaacatataaagcagtaaaagtgagtggcatcgaa
ccaggacaatggttaggcgtatttggtgtgggcggattaggtaatttagcattgcaatac
gccaaaaacgtaatgggcgcgaaagttgttgcattcgacattaatgatgataaattaaat
tttgctaaagagcttggtgctgatgcaatcataaattcaactaatgttgatcctattgag
gaagttaatcgtctaacgaataataaaggattagatgcaacggtgattactgctgtagct
aaaacaccttttaatcaagcagtggatgttgttaaggcgggtgcacgtgtggtagcagta
ggacttccagtagacaaaatggatttagatattccacgtttagtgcttgatggaattgaa
gtcgttggctcattagttggtaccagacaagatttaagagaagcatttcaatttgctgcc
gaaaataaagttattcctaaagtccaattaagacaattatctgaaattaacgatattttt
gatgaaatggaaaagggaacaatcacaggtcgaatggtcattgatatgaaaagctcgcac
taa

DBGET integrated database retrieval system