KEGG   Staphylococcus epidermidis RP62A: SERP0389Help
Entry
SERP0389          CDS       T00229                                 

Definition
(GenBank) alcohol dehydrogenase, iron-containing
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00010  Glycolysis / Gluconeogenesis
ser00071  Fatty acid degradation
ser00350  Tyrosine metabolism
ser00620  Pyruvate metabolism
ser00625  Chloroalkane and chloroalkene degradation
ser00626  Naphthalene degradation
ser00650  Butanoate metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP0389
   00620 Pyruvate metabolism
    SERP0389
   00650 Butanoate metabolism
    SERP0389
  Lipid metabolism
   00071 Fatty acid degradation
    SERP0389
  Amino acid metabolism
   00350 Tyrosine metabolism
    SERP0389
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SERP0389
   00626 Naphthalene degradation
    SERP0389
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SERP0389
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SERP0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AAW53770
UniProt: Q5HR06
Position
complement(389609..392218)
Genome map
AA seq 869 aa AA seqDB search
MLSVTKKNTYESNKDEVTQMIDSLAEKGQEALKELSKKSQHEINDIVHQMSMAAVDQHMH
LAKLAYDETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGEDKQKGLTYVAEPIGVIC
GVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQQSSKYAAKVILEAATKAGAPKDCIQ
WIEVPSIEATKQLMNHKDIALVLATGGSGMVKSAYSTGKPALGVGPGNVPTYIEKTAHIK
RAVNDIIGSKTFDNGMICASEQVMVVDKEVYTDVVKEFKLHQTYFVNKNELQQLEDAIMN
EDKTAVKPDIVGKSAVDIAKLSGISVPEKTKLLVAEIDGIGKDYPLSREKLSPVLAMVTA
KSTGHALQICEDILKFGGLGHTAVIHTEDSQLQQKFGLKMKACRVLVNTPSAVGGIGNMY
NELIPSLTLGCGSYGRNSISHNVSAVDLLNIKTIAKRRNNMQWFKLPPKVYFEENSVMYL
TEMDNVERVMIVCDPGMVNIGYTDIVEQVLRRRENQPQIKVFNEVEPNPSTHTVYKGLEM
FINFQPNTIIALGGGSAMDAAKAIWMFFEHPETSFFGAKQKFLDIRKRTYKITKPKNAKF
ICIPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDIAIVDPQFVLSVPKDVAADTGM
DVLTHAIESYVSVMASDYTRGLSLQAIKLTFDYLKSSVQENDKHSREKMHNASTMAGMAF
ANAFLGISHSIAHKIGGEYGIPHGRTNAILLPHVIRYNAKDPQKHALFPKYDFFRADTDY
ADIAKFLGLKGNTTEELVDALANAVYDLGCSVGIDMNLKSQGVTEELLHSTIDRMAELAF
EDQCTTANPKEPLISELKGIIETAYDYER
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgtaactaaaaaaaatacatatgaatcaaacaaagatgaagtcacacaaatg
attgattcattagcagaaaaaggacaagaagctctaaaagaactatctaaaaaatcacaa
catgagattaatgacattgtacatcagatgagcatggctgctgttgatcagcatatgcat
ttagctaaactagcttacgacgaaacaggtagaggtatttatgaagacaaagctatcaaa
aatttatatgcctcagagtacatatggaattcaatcaaagacaataaaacagtaggtatc
ataggtgaagataaacaaaaaggattaacgtatgtagctgaacctataggcgtgatttgt
ggagtgacaccaacgaccaaccctacatctacaactattttcaaagcaatgattgctatt
aaaacaggtaatccaattattttcgcatttcatccaagtgcacaacaatcatcaaaatat
gctgctaaagtcattttagaagctgcaacaaaagcaggtgctcctaaagattgtattcaa
tggatagaagtgccatcaattgaggcaactaaacaattaatgaatcataaagatattgct
ttagttctagcgactggaggctctggaatggtaaagtccgcatattcgacaggtaaacct
gcattaggagtcggtccaggtaatgttcctacttatattgaaaaaactgctcatatcaaa
cgtgctgttaatgatatcattggttctaaaacttttgataatggtatgatttgtgcttct
gaacaagtcatggttgttgataaagaagtatacactgacgtcgttaaagaattcaaatta
caccaaacatattttgttaataaaaatgaactacaacaattagaagatgccatcatgaat
gaagataaaactgcagttaaacctgatatagttggtaaatctgctgtagatatagcgaaa
ttgtcaggaattagtgttccagaaaaaacaaaattattagtcgcagaaattgatggaatt
ggaaaagattatcctttatcacgtgaaaaattatcacctgtactcgcaatggtaactgca
aaatcaacaggacatgcactacaaatttgtgaagacatattaaaatttggtggtttaggt
cacactgctgtaattcacaccgaggatagtcaattacaacaaaaattcggtctaaaaatg
aaagcttgccgtgtattggtaaatacaccttctgctgtcggaggaattggaaatatgtat
aatgaactcattccttcactcacgttaggttgtggttcatatggtagaaattctatttct
cataatgtaagcgcagtagacttattaaatattaaaacaatagcaaaacgtcgtaataat
atgcaatggtttaaactcccacctaaagtttattttgaagaaaattcagttatgtatttg
acagagatggataatgttgaacgtgtaatgatagtttgtgatccaggaatggttaatatt
ggttatactgatatagttgaacaagtgctgagacgccgagaaaaccaaccacaaatcaaa
gtgtttaacgaagttgaacctaatccatcaactcatacagtctataaggggttagaaatg
tttataaatttccaacctaatactattattgcactcggtggcggttcggcaatggatgca
gccaaagcaatatggatgttctttgagcatccagaaacttcattttttggggcaaaacaa
aagttcttagatattcgtaaacgtacttataaaattaccaaacctaaaaacgcaaaattt
atatgtataccaacgacatcaggaactggttctgaagtgacaccttttgcagtaattact
gatagcgagacacacgttaagtatccactagcagattatgcgttaactcccgatattgct
atcgtcgatccacaattcgtattaagtgtacctaaagatgttgccgcagatacaggaatg
gatgttttgacacatgccattgaatcttacgtctctgtcatggcttcagattatacaaga
ggcttaagcttacaagcaataaagttaacttttgattatctaaaatcatcagttcaagaa
aatgacaaacactcacgagaaaaaatgcataatgcttcaacaatggccggtatggcattt
gccaatgcttttttaggaatttctcattctatcgcacataaaattggtggtgaatatggt
attccccacggcagaacaaatgctattttattaccacatgtcattcgctataatgccaaa
gatccacaaaaacatgcactgtttcctaaatatgatttctttagagcagatactgactat
gctgacattgcaaaatttttaggactcaaaggtaatacaactgaagaattagtggatgct
ctagctaatgcggtgtatgatttaggatgttcagttggtattgatatgaatttaaaatca
caaggcgtaactgaagagcttcttcactctactatagacagaatggctgaattagcattt
gaagatcaatgtacaactgctaatccaaaagaaccgctaattagtgaacttaaaggcatt
atcgaaacagcatatgattatgaaagataa

DBGET integrated database retrieval system