KEGG   Staphylococcus epidermidis RP62A: SERP0444Help
Entry
SERP0444          CDS       T00229                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP0444 (tpiA)
   01230 Biosynthesis of amino acids
    SERP0444 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP0444 (tpiA)
   00051 Fructose and mannose metabolism
    SERP0444 (tpiA)
   00562 Inositol phosphate metabolism
    SERP0444 (tpiA)
Enzymes [BR:ser01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SERP0444 (tpiA)
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SERP0444 (tpiA)
  Exosomal proteins of bladder cancer cells
   SERP0444 (tpiA)
  Exosomal proteins of melanoma cells
   SERP0444 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448998..449759
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNELPTLPDPKEVESVICAPTIQLDALVTAVKDGKAKG
LKIGAQNAYFEESGAYTGETSPVALSELGVKYVVIGHSERRDYFHETDEEVNKKAHAIFN
HGMTPIICVGESDEEREAGKANKIVGNQVKKAVEGLSDDQLKEVVIAYEPIWAIGTGKSS
TSEDANEMCAHVRQTLADLSSQEVADATRIQYGGSVKPNNIKEYMAQSDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagccggaaactggaaaatgaataaaacagttcaagaagctaaa
gactttgtaaacgaattaccaacattacctgatcctaaagaagtagaatcagttatttgt
gcaccaacaatccaattagacgctttagtaacagctgttaaagatggtaaagcaaaaggg
ttaaaaattggagcacaaaacgcttactttgaagaaagcggtgcttatactggagaaact
tcaccagtagcattatctgaattaggtgttaaatatgtagtgattggtcactcagagcgt
cgtgactatttccacgaaactgacgaagaagtaaacaaaaaagcgcatgctatcttcaat
cacggtatgacacctattatttgtgtaggtgaatctgatgaagaacgtgaagctggtaaa
gcaaataaaatcgtaggtaatcaagtgaaaaaagctgtcgaaggtttatcagatgatcaa
cttaaagaagttgttattgcatatgaaccaatttgggctatcggtactggtaagtcatct
acatctgaagatgcaaatgaaatgtgtgctcacgtacgtcaaacattagctgacttatct
agtcaagaggttgctgacgctacacgtattcaatatggtggtagtgttaaacctaataac
attaaagaatatatggctcaatcagatatcgatggcgctcttgtaggtggcgcatcatta
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system