KEGG   Staphylococcus epidermidis RP62A: SERP0766Help
Entry
SERP0766          CDS       T00229                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00240  Pyrimidine metabolism
ser00250  Alanine, aspartate and glutamate metabolism
ser01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SERP0766 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SERP0766 (pyrB)
Enzymes [BR:ser01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SERP0766 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AAW54169
UniProt: Q5HPZ1
Position
764258..765139
Genome map
AA seq 293 aa AA seqDB search
MEHLLSMEHLSNSEIYDLITIACQFKSGERPLPQFNGQYVSNLFFENSTRTKCSFEMAEQ
KLGLKLINFETSTSSVKKGESLYDTCKTLESIGVDLLVIRHSQNSYYEELNQLNIPIANA
GDGSGQHPTQSLLDIMTIYEEYGSFEGLNILICGDIKNSRVARSNYHSLTSLGANVMFSS
PKEWVDNTLEAPYVEIDEVIDKVDIVMLLRVQHERHGISGEANFAAEEYHQQFGLTQARY
DKLKEEAIVMHPAPVNRGVEIKSELVEAPKSRIFKQMENGMYLRMAVISALLQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggaacacttattatcaatggagcatttatctaattcagaaatttatgatttaattact
attgcttgccaattcaaatctggtgagcgaccattacctcaatttaacggtcaatacgta
tcaaacttattcttcgaaaattcaacgcgaacaaagtgtagctttgagatggcagaacaa
aaattaggattaaaacttattaattttgaaacaagtacatcatctgtaaaaaagggtgag
tcactttatgacacatgtaaaacacttgaaagcataggtgttgatttacttgtcatacgt
cactcccaaaattcttattacgaagaactgaatcaattaaatattccaattgctaatgca
ggtgatggaagtggacaacatcctactcagagtttattagacataatgacaatatatgaa
gaatatggttcgtttgaaggattgaatattctaatatgtggtgacattaaaaattctcgt
gtcgcaagaagtaattatcatagtttaacatcattaggtgccaacgtaatgttctcaagt
ccaaaagaatgggtagataatacattagaggcgccttatgttgaaattgatgaagtcatt
gataaagtagatattgttatgttgcttagagttcaacatgaaagacatggaatttcaggt
gaagctaactttgctgctgaggaatatcatcaacaatttggtttaacacaggctagatat
gataaattaaaagaggaagccattgtaatgcatccagctcctgtaaatagaggtgttgaa
attaaaagtgagctagttgaagcacctaagtctcgaatatttaagcagatggaaaatgga
atgtatttaagaatggcagtaataagtgcgcttttacaatag

DBGET integrated database retrieval system