KEGG   Staphylococcus epidermidis RP62A: SERP0898Help
Entry
SERP0898          CDS       T00229                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SERP0898 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP0898 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SERP0898 (thrC)
Enzymes [BR:ser01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SERP0898 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909067..910131
Genome map
AA seq 354 aa AA seqDB search
MKRWQGLVKEFKEYLPVNQSTPALTLNEGHTPLIYCENLSQKLDIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKVVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAEENDEIELVNSVNPFRIEGQKTGAFEIVEQLDGQA
PDILAIPVGNAGNITAYWQGFVEYHNKKNTQLPQMFGFQAEGASPIVQNKIIKNPETIAT
AIRIGNPASWQKAVNALDESNGLIDSVIDEEILEAYQLMTTNEGVFSEPASNASIAGLIK
LHRSGKLPKGKKIVAILTGNGLKDPDTAISLLDNPIQPLPNNKESIIRYIKGAI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggattagttaaagaatttaaagaatatttaccagtcaatcaatct
acaccagcactaacactcaatgaaggacatacaccacttatttattgtgaaaatctttct
caaaaattagatattgaattatatgttaaatatgaaggagcaaatccgactggctcattt
aaagatcgtggtatggttatggctgtaacaaaggcaaaagaacaagggaaaaaagttgtt
atttgtgcttcaactggtaatacttcagcatcagcagctgcttatgctgcaagagctggt
ttaaaagcaattgtcgtaattcctgaaggtaaaatagcattaggtaaattatcacaagca
gttatgtatggtgcagaaattgtttctatagaaggaaacttcgatgaagcactagaaatt
gtaaaagagattgctgaagaaaatgatgaaattgaattagttaattctgttaatccattt
aggattgaaggacaaaagacgggtgcctttgaaattgttgaacagttagatggtcaagcc
cctgacattttagcaataccagtgggaaatgcaggtaatataactgcttattggcaagga
tttgttgaatatcataataaaaagaatacacaattaccacaaatgtttggcttccaagca
gaaggagcatctccaattgttcaaaataaaataatcaaaaatccagaaacaatagctaca
gctatccgaatagggaatcctgctagttggcaaaaagctgttaatgcactagatgaatca
aatggtttaattgatagtgtgatagatgaagaaattttagaagcttatcagttaatgaca
acaaatgaaggtgtttttagtgaaccagcgagtaatgcttcaattgcaggtctaatcaaa
cttcatcgctctggtaagttacctaaaggtaaaaagatagttgcaatattaactgggaat
ggacttaaagatcctgacacagctatttctctcttagataatcctattcaacctttacct
aataataaagaaagtataattagatacatcaaaggggcaatctag

DBGET integrated database retrieval system