KEGG   Staphylococcus epidermidis RP62A: SERP0898Help
Entry
SERP0898          CDS       T00229                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00260  Glycine, serine and threonine metabolism
ser00750  Vitamin B6 metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01230  Biosynthesis of amino acids
Module
ser_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP0898 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SERP0898 (thrC)
Enzymes [BR:ser01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SERP0898 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 DUF4687 PK_C
Motif
Other DBs
NCBI-ProteinID: AAW54258
UniProt: Q5HPL3
Position
909067..910131
Genome map
AA seq 354 aa AA seqDB search
MKRWQGLVKEFKEYLPVNQSTPALTLNEGHTPLIYCENLSQKLDIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKVVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAEENDEIELVNSVNPFRIEGQKTGAFEIVEQLDGQA
PDILAIPVGNAGNITAYWQGFVEYHNKKNTQLPQMFGFQAEGASPIVQNKIIKNPETIAT
AIRIGNPASWQKAVNALDESNGLIDSVIDEEILEAYQLMTTNEGVFSEPASNASIAGLIK
LHRSGKLPKGKKIVAILTGNGLKDPDTAISLLDNPIQPLPNNKESIIRYIKGAI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggattagttaaagaatttaaagaatatttaccagtcaatcaatct
acaccagcactaacactcaatgaaggacatacaccacttatttattgtgaaaatctttct
caaaaattagatattgaattatatgttaaatatgaaggagcaaatccgactggctcattt
aaagatcgtggtatggttatggctgtaacaaaggcaaaagaacaagggaaaaaagttgtt
atttgtgcttcaactggtaatacttcagcatcagcagctgcttatgctgcaagagctggt
ttaaaagcaattgtcgtaattcctgaaggtaaaatagcattaggtaaattatcacaagca
gttatgtatggtgcagaaattgtttctatagaaggaaacttcgatgaagcactagaaatt
gtaaaagagattgctgaagaaaatgatgaaattgaattagttaattctgttaatccattt
aggattgaaggacaaaagacgggtgcctttgaaattgttgaacagttagatggtcaagcc
cctgacattttagcaataccagtgggaaatgcaggtaatataactgcttattggcaagga
tttgttgaatatcataataaaaagaatacacaattaccacaaatgtttggcttccaagca
gaaggagcatctccaattgttcaaaataaaataatcaaaaatccagaaacaatagctaca
gctatccgaatagggaatcctgctagttggcaaaaagctgttaatgcactagatgaatca
aatggtttaattgatagtgtgatagatgaagaaattttagaagcttatcagttaatgaca
acaaatgaaggtgtttttagtgaaccagcgagtaatgcttcaattgcaggtctaatcaaa
cttcatcgctctggtaagttacctaaaggtaaaaagatagttgcaatattaactgggaat
ggacttaaagatcctgacacagctatttctctcttagataatcctattcaacctttacct
aataataaagaaagtataattagatacatcaaaggggcaatctag

DBGET integrated database retrieval system