KEGG   Staphylococcus epidermidis RP62A: SERP0940Help
Entry
SERP0940          CDS       T00229                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01130  Biosynthesis of antibiotics
ser01230  Biosynthesis of amino acids
Module
ser_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SERP0940 (trpC)
Enzymes [BR:ser01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SERP0940 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE Radical_SAM His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAW54337
UniProt: Q5HPH2
Position
957055..957843
Genome map
AA seq 262 aa AA seqDB search
MTILNEIIEYKKTLLERKYYDKKLEILQDNGNVKRRKLIDSLNYDRTLSVIAEIKSKSPS
VPQLPQRDLVQQVKDYQKYGANAISILTDEKYFGGSFERLNQLSKITSLPVLCKDFIIDK
IQIDVAKRAGASIILLIVNILSDDQLKELYSYATNHNLEALVEVHTIRELERAHQINPKI
IGVNNRDLKRFETDVLHTNKLLKFKKSNCCYISESGIHTKEDVEKIVDSSIDGLLVGEAL
MKTNDLSQFLPSLKLKKNLYDS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactattttaaatgaaattattgagtataaaaaaactttgcttgagcgtaaatactat
gataaaaaacttgaaattttacaagataacggaaatgttaagaggagaaagctgattgat
tcacttaactatgatagaacattatcagttattgctgaaataaaatcgaaaagcccatct
gtacctcaattaccgcaacgtgatcttgttcaacaagttaaagattatcaaaaatatggt
gctaatgctatttcaatattaactgatgaaaaatactttggcggtagttttgaacgatta
aatcagttatcaaagataacatcgttaccagttttatgtaaagattttattattgataaa
attcaaatagatgttgcaaaacgagctggtgcatctattattttattaatagtaaatatt
ttaagtgatgaccaattaaaagaattgtattcatatgcaacaaaccataatttagaagct
ctagtagaagttcatacaattagagaacttgaacgtgcacaccaaattaaccctaaaatt
attggtgttaataatcgtgatttaaaacgatttgaaaccgatgttctacatacaaataaa
ttacttaagtttaaaaagtctaattgctgctacatttcagagagtggcattcatacaaaa
gaagatgttgagaaaatagtagattcaagtattgacggtttacttgtaggggaggcatta
atgaaaacaaatgacttaagtcagtttttgcctagtttaaagttaaagaagaatctctat
gatagttaa

DBGET integrated database retrieval system