KEGG   Staphylococcus epidermidis RP62A: SERP0942Help
Entry
SERP0942          CDS       T00229                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SERP0942 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP0942 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SERP0942 (trpB)
Enzymes [BR:ser01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SERP0942 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
958460..959668
Genome map
AA seq 402 aa AA seqDB search
MKIQTEVDELGFFGEYGGQYVPETLMPAIIELKKAYEDAKSDTHFKKEFNYYLSEYVGRE
TPLTFAESYTKLLGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKTKLVAETGAGQH
GVASATIAALFDMDLIVFMGSEDIKRQQLNVFRMELLGAKVVSVSDGQGTLSDAVNKALQ
YWVNHVEDTHYLLGSALGPDPFPTMVRDFQSVIGNEIKSQILSKEGRLPDALVACVGGGS
NSIGTFYPFIQDDVKLYGVEAAGKGSHTHNHALAIGKGKPGVLHGSKMYLIQNDDGQIEL
AHSISAGLDYPGIGPEHSYYNDIGRVSYVSATDNEAMEALITFSKVEGIIPAIESAHALS
YVEKLAPNMDEKEIIVVTISGRGDKDMETIKQYKENGGEQNE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaaacagaagtagatgaattgggctttttcggtgaatatggtggccaatat
gtacctgaaacattgatgccagctattattgaacttaaaaaagcatatgaggacgcgaaa
tcagatactcacttcaagaaagaatttaattattatttaagtgaatatgttggtagagaa
acgcctttaacatttgctgaatcatacacaaaattgttaggtggtgccaaaatatatctt
aaaagagaagacttaaatcacactggtgctcataaaattaataacgcgataggacaggca
ctattagctaaaaggatggggaaaactaaattagtagccgaaacaggtgctggtcaacat
ggtgtagcaagtgccaccatcgctgctttattcgatatggatcttattgttttcatggga
agtgaagatatcaaacgtcaacaacttaacgtatttagaatggaattgctaggagctaaa
gtagtgtctgtgtcagatgggcaaggaacactatcagatgctgtaaataaagctttgcaa
tattgggtgaatcatgtcgaggatacacattatttattaggctcagcgttgggacctgat
ccgtttccaactatggtcagagattttcagagtgtgattggtaatgaaattaaaagccaa
attttaagtaaagaaggacgacttccagatgcgttagtcgcgtgtgttggtggaggatcc
aattcaataggtacgttctatccatttatacaagatgatgttaaattatatggggtagaa
gctgcgggaaaaggaagtcatacgcataatcatgctttagctatagggaaaggtaaacca
ggtgtattacatggttccaaaatgtaccttattcaaaatgatgatggacaaattgaattg
gcacactctatatcagcgggactagattatccaggtattggacctgaacattcgtattat
aatgatattggtcgtgtatcatatgtaagtgctacagataatgaagctatggaagcactt
ataacattctcaaaagttgaaggtatcattccagcaattgaaagtgcacatgcattgagt
tatgttgaaaaattagcgccaaatatggatgaaaaagaaattattgttgtgactatttca
ggtcgtggagataaagatatggaaacaattaaacaatacaaagaaaacggtggtgaacaa
aatgagtaa

DBGET integrated database retrieval system