KEGG   Staphylococcus epidermidis RP62A: SERP0942Help
Entry
SERP0942          CDS       T00229                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00260  Glycine, serine and threonine metabolism
ser00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01130  Biosynthesis of antibiotics
ser01230  Biosynthesis of amino acids
Module
ser_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP0942 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SERP0942 (trpB)
Enzymes [BR:ser01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SERP0942 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAW54339
UniProt: Q5HPH0
Position
958460..959668
Genome map
AA seq 402 aa AA seqDB search
MKIQTEVDELGFFGEYGGQYVPETLMPAIIELKKAYEDAKSDTHFKKEFNYYLSEYVGRE
TPLTFAESYTKLLGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKTKLVAETGAGQH
GVASATIAALFDMDLIVFMGSEDIKRQQLNVFRMELLGAKVVSVSDGQGTLSDAVNKALQ
YWVNHVEDTHYLLGSALGPDPFPTMVRDFQSVIGNEIKSQILSKEGRLPDALVACVGGGS
NSIGTFYPFIQDDVKLYGVEAAGKGSHTHNHALAIGKGKPGVLHGSKMYLIQNDDGQIEL
AHSISAGLDYPGIGPEHSYYNDIGRVSYVSATDNEAMEALITFSKVEGIIPAIESAHALS
YVEKLAPNMDEKEIIVVTISGRGDKDMETIKQYKENGGEQNE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaaacagaagtagatgaattgggctttttcggtgaatatggtggccaatat
gtacctgaaacattgatgccagctattattgaacttaaaaaagcatatgaggacgcgaaa
tcagatactcacttcaagaaagaatttaattattatttaagtgaatatgttggtagagaa
acgcctttaacatttgctgaatcatacacaaaattgttaggtggtgccaaaatatatctt
aaaagagaagacttaaatcacactggtgctcataaaattaataacgcgataggacaggca
ctattagctaaaaggatggggaaaactaaattagtagccgaaacaggtgctggtcaacat
ggtgtagcaagtgccaccatcgctgctttattcgatatggatcttattgttttcatggga
agtgaagatatcaaacgtcaacaacttaacgtatttagaatggaattgctaggagctaaa
gtagtgtctgtgtcagatgggcaaggaacactatcagatgctgtaaataaagctttgcaa
tattgggtgaatcatgtcgaggatacacattatttattaggctcagcgttgggacctgat
ccgtttccaactatggtcagagattttcagagtgtgattggtaatgaaattaaaagccaa
attttaagtaaagaaggacgacttccagatgcgttagtcgcgtgtgttggtggaggatcc
aattcaataggtacgttctatccatttatacaagatgatgttaaattatatggggtagaa
gctgcgggaaaaggaagtcatacgcataatcatgctttagctatagggaaaggtaaacca
ggtgtattacatggttccaaaatgtaccttattcaaaatgatgatggacaaattgaattg
gcacactctatatcagcgggactagattatccaggtattggacctgaacattcgtattat
aatgatattggtcgtgtatcatatgtaagtgctacagataatgaagctatggaagcactt
ataacattctcaaaagttgaaggtatcattccagcaattgaaagtgcacatgcattgagt
tatgttgaaaaattagcgccaaatatggatgaaaaagaaattattgttgtgactatttca
ggtcgtggagataaagatatggaaacaattaaacaatacaaagaaaacggtggtgaacaa
aatgagtaa

DBGET integrated database retrieval system