KEGG   Staphylococcus epidermidis RP62A: SERP0943Help
Entry
SERP0943          CDS       T00229                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SERP0943 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP0943 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SERP0943 (trpA)
Enzymes [BR:ser01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SERP0943 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
959661..960392
Genome map
AA seq 243 aa AA seqDB search
MSKLFIPYIMGDLNFIHHLKTLTENGADIVEIGVPFSDPVADGPIIMKAGRNAIDEGSNI
KFIFDELIKNKNTISSKYVLMTYYNILSAYGEELFLDKCDEAGVYGLIIPDLPYELTKKF
KKDFYHHSVKIISLIAMTASDARIMQIAKNSEGFIYTVTMNATTGNSGEFHPDLKRKIEY
IKKVSKIPVVAGFGIKNPEHVKDIASVADGIVIGSEIVKRIEIDSRKEFITYIKSIRTTL
NSL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattattcattccgtatattatgggtgatttaaattttattcatcatttaaaa
acattaactgagaatggagcagacattgttgaaattggtgtgccattttctgatcctgtt
gcagatggacctataatcatgaaagcagggcgcaacgctattgacgagggttcaaacatt
aaattcatttttgatgaattaataaaaaataaaaatactatttcatctaagtatgtatta
atgacttattataatattctaagtgcttatggagaagaattatttttggataagtgtgat
gaagctggtgtttatggtttaattattccagatttaccttacgaacttacaaaaaagttt
aaaaaagatttttatcatcattctgttaaaataatatcgttaattgccatgaccgcaagt
gatgctaggattatgcaaattgcaaagaactcagaaggatttatttacacggtaacaatg
aatgccacaacaggtaacagtggggagttccatccagatttaaagagaaaaattgaatat
ataaaaaaagtttcaaaaattcctgtggttgctggatttggtatcaaaaatcctgaacat
gttaaagatatagcgtccgttgcagatggtattgtaattggtagtgaaattgtaaaacgt
attgaaatagattcaagaaaagaatttatcacttatatcaaatcaataagaaccacgttg
aattctttataa

DBGET integrated database retrieval system