KEGG   Staphylococcus epidermidis RP62A: SERP0985Help
Entry
SERP0985          CDS       T00229                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydroipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00020  Citrate cycle (TCA cycle)
ser00310  Lysine degradation
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01200  Carbon metabolism
Module
ser_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ser_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SERP0985 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SERP0985 (sucB)
Enzymes [BR:ser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SERP0985 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Macoilin
Motif
Other DBs
NCBI-ProteinID: AAW54332
UniProt: Q5HPC7
Position
complement(1001204..1002466)
Genome map
AA seq 420 aa AA seqDB search
MAEVKVPELAESITEGTIAEWLKNVGDNVDKGEAILELETDKVNVEVVSEEAGVLSEQLA
EEGDTVEVGQAVAVVGEGQVNTSNDSSNESSQKDEAKEKETPKQSNPNSSESENTQDNSQ
QRINATPSARRHARKNGVDLSEVSGKGNDVLRKDDVENSQKSSSQTAKSESKSQNSGSKQ
TNNNPSKPVIREKMSRRKKTAAKKLLEVSNQTAMLTTFNEVDMTNVMDLRKRKKEQFIKD
HDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQFYDIGIAVSTDDGLLVPFVRD
CDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAAIL
GMHSIITRPIAVDKDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLLES
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtaaaagttccagaattagcagaatcaatcacagagggtaccattgcagaa
tggttaaaaaatgtaggcgataatgtagataaaggtgaagctatcttagaactagaaaca
gataaagttaacgtcgaagtagtttctgaagaagctggggtattatcagaacaattagcc
gaggaaggcgatacagttgaagtaggtcaagctgtagctgtagtaggagaaggacaagta
aacacatctaacgatagttctaacgaatcttcacaaaaagatgaagctaaagagaaagaa
acgccaaaacaatctaacccgaattctagtgaaagtgaaaatacacaagataatagccag
caacgtatcaatgcaacaccatctgcacgtcgacatgcgcgtaaaaatggcgttgattta
agcgaagtatccggaaaaggcaatgatgttctaagaaaagatgatgttgaaaatagtcaa
aaatcttcaagtcaaacagctaaaagtgaaagcaaatcacaaaacagtggttctaaacaa
accaataacaatccatcaaaacctgttattcgtgaaaaaatgtctcgacgcaaaaaaact
gctgcaaaaaaattattagaagtatcaaatcaaacagctatgcttactacatttaatgaa
gttgatatgacaaacgttatggatttacgtaaacgtaaaaaagaacaatttatcaaagat
catgatggtactaaattaggatttatgtccttctttactaaagctgccgttgcagctctc
aaaaaatatcctgaagtaaatgctgagatagatggcgatgatatgattactaaacaattt
tacgatatcggcattgcagtatccactgacgatggattactcgtaccatttgttagagat
tgtgataagaaaaattttgcagaaattgaacaagaaatcgctaatttagccgtaaaagct
cgtgataaaaaattaggccttgatgacatggttaacggttcgtttaccatcactaatggc
ggtatctttggctcaatgatgagtacaccgattataaatggtaatcaagcagctatctta
ggtatgcattcaattattacacgcccaattgcagttgataaagatacaattgaaaatcgt
ccaatgatgtatatcgcattaagctatgatcatagaatcatcgatgggaaagaggctgta
ggattcttaaaaaccattaaagaactcattgaaaatcctgaagatttattacttgaatca
taa

DBGET integrated database retrieval system