KEGG   Staphylococcus epidermidis RP62A: SERP1002Help
Entry
SERP1002          CDS       T00229                                 

Gene name
folA-1
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ser00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ser00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1016993..1017478)
Genome map
AA seq 161 aa AA seqDB search
MTLSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRN
VVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLFEAMIDQVDDMYITVIDGKFQG
DTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRKGK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcaataattgtcgctcacgataaacaaagagtcattgggtaccaaaatcaa
ttaccttggcacttaccaaatgatttaaagcatgttaaacaactgaccactgggaataca
cttgtaatgggacggaaaacttttaattctatagggaaaccattgccaaatagacgtaac
gtcgtactcactaaccaagcttcatttcaccatgaaggggtagatgttataaactctctt
gatgaaattaaagagttatctggtcatgtttttatatttggaggacaaacgttattcgag
gcaatgattgaccaggtagatgatatgtatatcacagtaatagatggaaagtttcaagga
gacacattctttccaccatacacattcgaaaactgggaagtcgaatcttcagtagaaggt
caactagatgaaaaaaatactataccgcatacattcttacatttagtgcgtagaaaaggg
aaatag

DBGET integrated database retrieval system