KEGG   Staphylococcus epidermidis RP62A: SERP1262Help
Entry
SERP1262          CDS       T00229                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP1262 (pfkA)
   01230 Biosynthesis of amino acids
    SERP1262 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP1262 (pfkA)
   00030 Pentose phosphate pathway
    SERP1262 (pfkA)
   00051 Fructose and mannose metabolism
    SERP1262 (pfkA)
   00052 Galactose metabolism
    SERP1262 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SERP1262 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SERP1262 (pfkA)
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SERP1262 (pfkA)
Protein phosphatases and associated proteins [BR:ser01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SERP1262 (pfkA)
Messenger RNA biogenesis [BR:ser03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SERP1262 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303827..1304795)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVTRTAIYNNIEVYGVYQGYQGLLDDDIHKLELGSVGDT
IQRGGTFLFSARCPQFKEEDVRKKAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIESVDKIRDTASSHARTFIVEVMGRDCGDLAL
WAGLSVGAETIVLPEVNTDIKDVAEKIEQGIKRGKKHSIVMVAEGCMSGQECADELTKYI
NIDTRVSVLGHIQRGGSPSGADRVLASRLGGYAVELLKQGETAKGVGIRNNQLTSTPFDE
IFAESNRKFNSQMYELAKELSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgcagttttaactagcggaggagattctccgggtatgaacgctgctgtt
cgtgcagtgactcggacagcaatttacaataatattgaagtttatggtgtttatcaaggt
taccaaggtttacttgatgatgatattcataagcttgaattgggttcagtaggggataca
attcaacgaggaggaactttcctcttttccgcaaggtgccctcagttcaaagaagaggat
gtacgtaagaaagctattgagaatttacgtaagcgtggtatcgaaggtttagttgttatt
ggaggagatggcagctatagaggggcacaacgaattagtgaggaatgtaaagaaattcaa
acaattggtattcctggtacaattgataatgatattaatggtacagattttacaattggt
tttgatactgcattaaacactattattgaatcagtcgataagattagagatacggcatca
agtcacgcaagaacgtttattgttgaagttatggggcgtgattgtggagatttagcttta
tgggctggattatctgtaggtgctgaaacgattgttttaccagaagtcaatacagatatt
aaggatgtagctgaaaagattgaacagggtattaaaagagggaaaaaacattctatcgtt
atggttgcagaaggttgtatgagcggccaagaatgtgcagatgagttaacgaagtatatt
aacattgatacacgagtttcagtgttaggtcacattcaacgtggcggtagcccatctggt
gctgatcgagtattagcttctcgacttggtggatatgctgttgaactattaaaacaaggc
gagacagctaaaggtgttggcattaggaataatcaattaacctctacgccgtttgatgaa
atttttgctgaaagtaatcgcaaatttaatagtcaaatgtatgaattagcaaaagaatta
tcaatttaa

DBGET integrated database retrieval system