KEGG   Staphylococcus epidermidis RP62A: SERP1366Help
Entry
SERP1366          CDS       T00229                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00860  Porphyrin and chlorophyll metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SERP1366 (hemG)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SERP1366 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SERP1366 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO MCRA Thi4 Pyr_redox_2 HI0933_like Pyr_redox NAD_binding_9 FMO-like FAD_binding_2 Mqo Semialdhyde_dh Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AAW54736
UniProt: Q5HNA6
Position
complement(1422508..1423956)
Genome map
AA seq 482 aa AA seqDB search
MAYFNKFLSNSERKRGKVSKKVAIIGAGITGLSSAYFIKKQDPSIEVTIFEASNRVGGKI
QTYRSDGYTIELGPESYLGRKTIMTDVAKDIGLENDLITNTTGQSYIFAKNKLYPIPGGS
IMGIPTDIKPFIKTRLISPIGKLRAGLDLFKKPIEIEDDISVGSFFRQRLGNEVLENLIE
PLMGGIYGTDIDQLSLMSTFPNFKEKEEQFGSLIKGMKDEKEQRIKKRQLYPGAPKGQFK
QFRHGLSSFIEALVKDIESKGVHIRYNTPVKDILISQKDYEILLEDDSKEKFNGLLVTTP
HQVFLNWFSHDPAFDYFKNMDSTTVATVVLAFDEKNITNTYDGTGFVIARTSQTDITACT
WTSKKWPFTTPEGKVLIRAYIGKPGDTVVDDHTDEEIVSIVRKDLSQMMTISGNPDFTIV
NRLPKSMPQYHVGHIKMIKEIQQHIKTTYPRLRVTGAPFEAVGLPDCIQQGKNAVDEILE
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattttaataaatttttaagcaattctgaaaggaagcgtggaaaagtgagtaag
aaagtggcaattattggagcgggaatcactggtttatctagcgcatatttcattaaaaaa
caagacccttctattgaagtaactatcttcgaagcctcaaatagagtaggtggaaagatt
caaacatatagatcagatggttacacaattgagttaggccctgagtcttatttaggtcgt
aagacaattatgactgatgtggcaaaagatattggattagaaaatgaccttataacaaat
actactggccaatcttatatttttgctaaaaataaattatatcctattcctggtggctca
attatgggaattcctacagatattaaaccatttattaaaacaagactcatttcacctatt
ggtaaattaagagcggggcttgatttgtttaaaaaaccgatagaaattgaagatgatatt
tctgttggtagtttctttagacaacgattaggtaatgaagtattagagaacttaattgaa
ccactaatgggtggtatttatggcactgatattgatcaattgagcttaatgagtacattt
cctaactttaaggaaaaagaggaacaatttggtagtttgattaaaggaatgaaagacgaa
aaagaacaacgtattaagaaacgtcaattatatccaggtgctcctaaaggacaattcaaa
cagtttagacacggattgagttcttttatagaggctcttgttaaagatattgaaagtaaa
ggtgtccacatacgatataacacgccagtcaaagatatattgatttcgcaaaaagattat
gaaattttattagaagatgacagtaaagagaaatttaatggcttacttgtaacaacacca
catcaagtatttctgaactggtttagtcacgatccagcatttgattactttaaaaacatg
gattctactactgtcgcaacagttgttttggcctttgatgagaaaaatattaccaatacg
tacgatggaactggctttgttattgcaagaacaagtcaaacggatattactgcatgtact
tggacatcaaagaaatggccatttactactccagaaggtaaagttttaattcgagcatat
ataggaaaaccaggtgatactgtagtagatgatcacaccgatgaagaaatagtatcaatt
gttagaaaagacttaagccaaatgatgaccatctcagggaatcctgattttacaattgta
aatcggttacctaagagtatgccccaataccacgtgggtcatattaaaatgattaaagaa
attcaacaacatattaaaacaacttatcctagattacgtgttacaggggcaccgtttgaa
gctgtcggtttaccagactgcatacaacaaggtaagaatgcagttgatgaaatattagaa
gagttataa

DBGET integrated database retrieval system