KEGG   Staphylococcus epidermidis RP62A: SERP1786Help
Entry
SERP1786          CDS       T00229                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K07119  
uncharacterized protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1831590..1832594)
Genome map
AA seq 334 aa AA seqDB search
MNNEQIVFNKVPDGMPQDDTFKYEDIDVIEPSENELQLKTLYISVDPYMRGRMTNADSYV
DPFKQGEPFNGHTVSKVLKSKDSNFDEGDIVVGMLPWRKINTVNSEYVNKVPTSDVPLHL
YLSVLGMPGQTAYHGLLDIGQPKEGETVVISAASGAVGSVVGQIAKLKGCRVVGIAGGDK
KVNYLKNELRFDAGIDYKKDNFPEALKEAVPNGIDVYFENVGGYIGDEVFKHLNTHARIP
VCGAISSYNHPEKDIGPRIQQTLIKNQAMMRGFIVAEFADGFKEASKQLAQWVQENKIKT
QVSVEDGFDKVPQAFRNLLTGDNFGKQVIKVASE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaacaaatagtatttaataaagtaccagacggaatgccacaagacgataca
tttaaatatgaagatatagatgttattgaaccttcagaaaatgaattgcaattgaaaaca
ttatatatatcggttgatccatatatgagaggacgtatgacaaatgctgattcttatgta
gatccgttcaaacaaggggaaccgttcaatggacatacggtatctaaagttttgaaatcc
aaggatagtaattttgatgaaggtgatatagtagtgggtatgctaccttggagaaaaata
aatacagtaaatagtgagtatgttaacaaagtacctacttctgacgtaccattacatctt
tatcttagtgtgttggggatgcctggtcagactgcttatcatggattacttgatattgga
caacctaaagaaggtgaaacagtagttatttcagcagcttcaggtgcagttggttcagtt
gtgggccaaattgcgaagcttaaaggttgcagagtcgttggtatagctggtggagataaa
aaagtgaactatctaaaaaatgaacttcgttttgatgctggtatcgattacaaaaaagat
aatttccctgaagcgttaaaagaagcggtgcctaacggtatagatgtctacttcgaaaat
gtaggtggatatattggcgatgaagtcttcaaacatctcaatacacatgcaagaattcct
gtttgtggtgcgatttcatcctataatcatccagaaaaagatattggaccacgcattcag
caaacattgattaaaaatcaagcaatgatgagaggtttcatagtagcagaattcgctgat
ggttttaaagaagcgagcaaacaattagctcaatgggttcaagagaataaaattaaaaca
caagtttcagtagaagatggttttgataaagtgccgcaagcctttagaaatctgctaact
ggtgataattttggtaaacaagttattaaagtggcaagtgaataa

DBGET integrated database retrieval system