KEGG   Staphylococcus epidermidis RP62A: SERP1786Help
Entry
SERP1786          CDS       T00229                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SERP1786
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP1786
  Lipid metabolism
   00071 Fatty acid degradation
    SERP1786
  Amino acid metabolism
   00350 Tyrosine metabolism
    SERP1786
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SERP1786
   00626 Naphthalene degradation
    SERP1786
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SERP1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1831590..1832594)
Genome map
AA seq 334 aa AA seqDB search
MNNEQIVFNKVPDGMPQDDTFKYEDIDVIEPSENELQLKTLYISVDPYMRGRMTNADSYV
DPFKQGEPFNGHTVSKVLKSKDSNFDEGDIVVGMLPWRKINTVNSEYVNKVPTSDVPLHL
YLSVLGMPGQTAYHGLLDIGQPKEGETVVISAASGAVGSVVGQIAKLKGCRVVGIAGGDK
KVNYLKNELRFDAGIDYKKDNFPEALKEAVPNGIDVYFENVGGYIGDEVFKHLNTHARIP
VCGAISSYNHPEKDIGPRIQQTLIKNQAMMRGFIVAEFADGFKEASKQLAQWVQENKIKT
QVSVEDGFDKVPQAFRNLLTGDNFGKQVIKVASE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaacaaatagtatttaataaagtaccagacggaatgccacaagacgataca
tttaaatatgaagatatagatgttattgaaccttcagaaaatgaattgcaattgaaaaca
ttatatatatcggttgatccatatatgagaggacgtatgacaaatgctgattcttatgta
gatccgttcaaacaaggggaaccgttcaatggacatacggtatctaaagttttgaaatcc
aaggatagtaattttgatgaaggtgatatagtagtgggtatgctaccttggagaaaaata
aatacagtaaatagtgagtatgttaacaaagtacctacttctgacgtaccattacatctt
tatcttagtgtgttggggatgcctggtcagactgcttatcatggattacttgatattgga
caacctaaagaaggtgaaacagtagttatttcagcagcttcaggtgcagttggttcagtt
gtgggccaaattgcgaagcttaaaggttgcagagtcgttggtatagctggtggagataaa
aaagtgaactatctaaaaaatgaacttcgttttgatgctggtatcgattacaaaaaagat
aatttccctgaagcgttaaaagaagcggtgcctaacggtatagatgtctacttcgaaaat
gtaggtggatatattggcgatgaagtcttcaaacatctcaatacacatgcaagaattcct
gtttgtggtgcgatttcatcctataatcatccagaaaaagatattggaccacgcattcag
caaacattgattaaaaatcaagcaatgatgagaggtttcatagtagcagaattcgctgat
ggttttaaagaagcgagcaaacaattagctcaatgggttcaagagaataaaattaaaaca
caagtttcagtagaagatggttttgataaagtgccgcaagcctttagaaatctgctaact
ggtgataattttggtaaacaagttattaaagtggcaagtgaataa

DBGET integrated database retrieval system