KEGG   Staphylococcus epidermidis RP62A: SERP1962Help
Entry
SERP1962          CDS       T00229                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00010  Glycolysis / Gluconeogenesis
ser00071  Fatty acid degradation
ser00350  Tyrosine metabolism
ser00625  Chloroalkane and chloroalkene degradation
ser00626  Naphthalene degradation
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP1962
  Lipid metabolism
   00071 Fatty acid degradation
    SERP1962
  Amino acid metabolism
   00350 Tyrosine metabolism
    SERP1962
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SERP1962
   00626 Naphthalene degradation
    SERP1962
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SERP1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AAW52853
UniProt: Q5HLM3
Position
1981471..1982463
Genome map
AA seq 330 aa AA seqDB search
MVEKFKAFVVDQDDNGIVSNSYKELTKDDLPEGDVLIKVHYSGINYKDALATQDHNKIVK
QYPMVPGIDLAGTIEETNAPGFEVGDKVIVTSYDLGVSHYGGFSEYARVKSEWVIELPED
LTLEEAMIYGTAGYTAGLAIEQLEKSGMSIEGKEVLVRGATGGVGTISLLMLNNLGYDVI
ASTGRDDAEEKLKKLGAKEVIGRLPEDNSKPLEKRTWQAAIDPVGGENLPYIVKRLDNNG
SVALIGMTGGNNFETTVFPFILRGASIIGIDSVFTPIKLRKRVWRRLAKDLKPQQLHDIK
HVISFDEIPKAIDQVINHNNTGRIVIDFNV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaattcaaagcttttgtagtcgatcaagatgacaacggtattgtttcaaat
agttataaagaactaactaaagatgacttacctgagggtgacgttttaataaaagtacat
tattctggcataaattataaagacgcactagccactcaggaccataacaaaatagtaaaa
caatatccgatggtccctggtatagatttagcaggtaccattgaggaaacaaatgctcca
ggctttgaggttggagataaagtcatcgtaacaagctatgatttaggtgtaagtcattac
ggaggcttcagtgaatacgcacgtgttaaatcagaatgggtgattgaattacctgaagat
ttaacattggaagaagctatgatttacggtactgctggctatacagcaggtttagctata
gaacaacttgaaaaatcaggtatgtctattgaaggtaaagaagtgcttgtacgaggtgcc
actggaggcgtcggaacgatttcattactcatgttaaataacttagggtatgatgttatt
gcaagtacgggtagagatgacgccgaagaaaaacttaaaaagcttggtgctaaagaagta
attggccgtttaccagaagataatagtaaaccattagagaagagaacatggcaggcagcc
attgatccagttggtggtgaaaacttaccgtacatcgtcaaacgattggataacaacgga
agtgttgcattaattggcatgactggtggtaacaattttgaaacaaccgtctttcctttc
attttaagaggagcaagtataattggtatcgattcagtatttactccaattaaactaaga
aaacgtgtttggagaagacttgcaaaagacttaaaaccacaacaattacatgacatcaaa
catgttatttcattcgatgaaatcccaaaagccatcgatcaagtcatcaatcataataat
actggacgtattgtcattgatttcaatgtttaa

DBGET integrated database retrieval system