KEGG   Staphylococcus epidermidis RP62A: SERP2056Help
Entry
SERP2056          CDS       T00229                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SERP2056 (galU)
   00052 Galactose metabolism
    SERP2056 (galU)
   00500 Starch and sucrose metabolism
    SERP2056 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SERP2056 (galU)
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SERP2056 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2080818..2081684)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASKAGIEDIIIVTGKH
KRAIEDHFDNQKELEMVLENKGKADLLEKVQYSTDLANIFYVRQKEQKGLGHAIHTAKQF
IGNEPFAVLLGDDIVESDTPAIKQLMDVYEETGHSVIGVQEVPESDTHRYGVIDPSAKEG
SRYEVRQFVEKPKQGTAPSNLAIMGRYVLTPEIFDYLETQQEGAGNEIQLTDAIERMNSK
QQVYAYDFEGNRYDVGEKLGFVKTTIEYALKDPEMSQDLKAFIKQLDI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagataaaaaaagcaataattcctgccgctggtttaggtactcgttttttacca
gcaactaaggcgatgccaaaagaaatgttaccaatattagataaaccaacaatccaatat
attgtagaagaagcttctaaagcagggattgaagatattattatagtgactggcaagcat
aaacgtgcaattgaagatcactttgataatcaaaaagaattagaaatggttcttgaaaat
aaaggaaaagcagacctgcttgaaaaagtacaatattcaacagatttagctaatattttt
tacgtacgacaaaaagaacaaaaagggctaggacatgcaattcatactgcaaaacagttt
atcggtaacgaaccatttgcagtgttattaggagatgacattgtagagtctgatactcca
gctattaaacaattaatggatgtttatgaagaaacaggccattcagtaataggggttcaa
gaagtgccagaatctgatacacatcgttatggtgtgattgatccttctgctaaagagggg
agtcgatatgaagtacgtcaatttgtagaaaagccgaaacaaggtactgccccgtctaat
ttagcaatcatgggtcgttatgtattaacaccagaaatttttgattatcttgaaacacaa
caagaaggtgctggaaatgaaattcaattaactgatgcgattgaacgaatgaatagcaaa
caacaagtgtatgcatatgattttgagggtaatcgttatgatgttggagaaaaattagga
tttgttaaaacaacgattgaatatgctttaaaagatccagaaatgagtcaagacttaaaa
gcattcattaagcaactagatatttaa

DBGET integrated database retrieval system