KEGG   Staphylococcus epidermidis RP62A: SERP2100Help
Entry
SERP2100          CDS       T00229                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SERP2100 (rbsK)
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SERP2100 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2124965..2125888)
Genome map
AA seq 307 aa AA seqDB search
MNKNKVIVIGSTNVDKFLNVKRFPKPGETLHINQAQKEFGGGKGANQAIAASRLAADTTF
ISKVGKDGNANFILEDFKKAGIHTQYILTSESEETGQAFITVDEAGQNTILVYGGANMTL
SATDVEMSVDAFIGADFVVAQLEVPFEAIEQAFKIARKQNITTVLNPAPAIELPKSLLEL
TDIIIPNETEAELLTGISINNESDMKETATYFLDLGISAVLITLGEQGTYCAYQEQYKMI
PACNVKAIDTTAAGDTFIGAFLSELNKDLSNLESAIRLANQASSLTVQRKGAQASIPTRK
EVEAEYN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaataaagtgattgtaattggatcaacaaatgtagataaatttcttaatgtt
aaaaggtttccaaaacccggtgagacattacatattaatcaagctcaaaaggagtttggt
gggggcaagggagccaatcaagccatagcagctagtagattagcagcagatacaacattt
atcagtaaagttggtaaagatggcaatgccaactttatattggaagatttcaaaaaagca
ggtattcatacacaatatattttaacttcagaaagtgaagaaactgggcaagcatttatc
actgttgatgaagcaggacaaaatacgattcttgtttacggtggtgcgaatatgacatta
agtgcaactgatgttgagatgagtgtggatgcgtttattggtgcagactttgttgtagcg
cagcttgaagttccatttgaggcgatagaacaagcatttaaaattgctcgtaaacaaaat
atcactactgtattaaatcctgcaccggcaattgaattgcctaagtcacttttagagtta
actgatataattattccaaacgaaacggaagcagaattattaacaggtatttcaatcaat
aatgaaagtgatatgaaagaaacagcaacatattttctcgatttaggtatatctgcagta
ttaattactttaggggagcaaggcacgtattgtgcatatcaagaacaatacaaaatgatt
cctgcgtgtaatgtaaaagcaatagatacgacagcagcaggagatacatttataggtgct
tttttaagtgagttaaataaagatttgagcaatttagaatcggctattcgacttgcaaat
caagcgtcgtctctaacggtacaacgaaaaggagcacaagcttctataccaacacgtaaa
gaagtagaggcagaatataattaa

DBGET integrated database retrieval system