KEGG   Staphylococcus epidermidis RP62A: SERP2112Help
Entry
SERP2112          CDS       T00229                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SERP2112
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SERP2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 TrkA_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AAW52989
UniProt: Q5HL75
Position
2135452..2136504
Genome map
AA seq 350 aa AA seqDB search
MKAYEYLKPGHAQLTDKEKPTITSSTDAIIRIVKTTICGTDLHIIKGDTPEVKSHTTLGH
EGIGIIEEIGDNVNNFKVGDKVIISCISSCGKCYYCKKGIYAHCENGGGWILGHLVNGTQ
AEYVKVPFADNSLYHAPSNLKEDALVMLSDILPTGYEIGVLKGKVKPGCTVAIVGAGPVG
LAALLTAQFYSPSKIIMIDLDDNRLETAKELGATHLINSKETETAIKKVKSLNPRGVDVA
IEAVGIPQTFDLCQNLIGVDGTIANVGVHGLPVQLDIDKLWIKNINVTTGLVSGNTTEEL
LEALKSKIIQPEQLVTHYSKLSEIESAYDLFRNATDHKAIKLIIENDITI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttatgaatacttaaaacctggtcatgcacaacttacggataaagagaagcca
actattacgagcagtactgacgctattattcgcatagttaagacgacaatatgtggtaca
gatcttcatatcataaaaggagatacacctgaagttaaatcacatacgacactaggtcac
gaaggtattggaatcattgaagaaattggtgacaacgttaacaacttcaaagttggagat
aaagtgattatctcttgcatttcatcatgtggcaaatgctactattgcaaaaaaggtatc
tatgcacattgtgaaaacggaggaggatggatattaggacatttagtgaatggtactcaa
gcagaatatgttaaagttccttttgcagataattctttatatcacgccccttcaaattta
aaagaagacgcccttgtaatgttatcagatatacttccaacaggttatgaaattggtgtt
ttaaaaggtaaagttaaacctggctgtacagtagccattgtaggtgctggtcctgtaggt
ttagcagcattacttacagcacaattctattcaccttcaaaaattattatgattgattta
gatgataatagattagaaaccgctaaagaactaggtgctacgcatttaattaactctaaa
gagactgaaaccgcaattaaaaaggtaaaatcgttaaatccacgtggtgttgatgttgct
attgaagctgtcggaattccacaaacctttgatttatgtcaaaatttaattggtgtcgat
ggtacgattgctaatgttggtgtgcatgggttacctgtacaacttgatatagataaatta
tggattaaaaatattaacgtaactactggtttagtttcaggaaatacaactgaagaatta
cttgaagcgttaaaaagcaaaataatacaaccagaacaactcgtgacacattatagtaaa
ctgagtgaaatcgaaagtgcctatgatttatttagaaatgcaacagatcataaagcgatt
aaattaatcatagagaatgatatcacaatttaa

DBGET integrated database retrieval system