KEGG   Staphylococcus epidermidis RP62A: SERP2137Help
Entry
SERP2137          CDS       T00229                                 

Definition
(GenBank) membrane protein, putative
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 DisA-linker PfkB
Motif
Other DBs
NCBI-ProteinID: AAW53037
UniProt: Q5HL50
Position
complement(2162461..2164269)
Genome map
AA seq 602 aa AA seqDB search
MNENNYRRLNKTYKPHYLPGLDGLRAIAVIGIIIYHLNTKWLSGGFLGVDTFFVISGYLI
TSLLLSEYYRNNSINLVNFWLRRFKRLIPAMMFVVTVVLIYTLLFKPELIISIKHDAIAA
LFYVSNWWYIIQDVDYFNQFAVAPLKHLWSLAIEEQFYLFFPFILLGLLKFFKKRTTMII
LLIISLLSLTAMITIHMYTGNNSRVYFGTDTRLQTLLLGCLLAFIWPPFSFRKDISKGAK
ASISAIGIVGMAVLIYLFVVVSDQDKWIYSGGFYAISFLTLFVIASVVHPSSVLKKILSF
KLFIYIGKRSYSLYLWHYPIIIFMNSYFVQGQIPWFVYICEVILMFVMAEVSYKFIETPI
RKNGFKAFTVIPKNLTRFSRTIIVLILLVPSAFIVFGAYDSLGKEHDKQQAAKQKSFKTN
QKAKPKKPDENNQDKSSQQHFNPKEASPLLLGDSVMVDIGQVFSEKVPNANIDGKVGRQL
IEGKDLINQKYQDYTKKGQSVVIELGTNGEFTKDQMNELIDSLGEADIYLIKVRVPRDYE
STNNKIMEQVAKKHKNVHIVDWYKTSEGHSEYFAYDGIHLEYSGVKALSNEIIKKMKEVN
EK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaacaattatagacgtctcaacaaaacttataaaccgcactatttgcctggt
ttagatggtttgagagctatagcagtcattgggataatcatttatcatttaaatacgaaa
tggttatctggtggattccttggagtagatactttttttgtcatttctggttatctcata
actagtttattattaagtgagtattatagaaataattctattaatttagttaatttttgg
cttagaagatttaaacgattaataccagcaatgatgtttgttgtcacggttgttttaata
tatacattactatttaaacccgaattaattattagtataaaacatgatgctatagcagca
cttttctatgtttctaactggtggtatatcatacaagacgtagactattttaatcaattt
gctgtagcgccattaaagcatttgtggtcattagctattgaagaacaattctatctattc
tttccatttatacttttaggcttattaaagtttttcaaaaagagaactacaatgattatt
ctattaatcatctctttattatcattaactgcaatgataacgatacatatgtatacaggt
aacaattctagagtttatttcgggactgacacacgtttacaaacgttattattaggatgc
ttactagcatttatttggccaccgttctctttcagaaaggatatatctaaaggtgctaaa
gcaagtataagtgcaataggcatagtcggaatggcagtgctcatttatttgtttgtagtg
gttagtgatcaagataaatggatatatagtggaggattttatgccatctcgttcttaaca
ctgtttgtcattgcaagcgttgtgcatccatcaagtgttttaaagaaaatactaagtttc
aagttatttatttatataggtaagagatcgtatagtttatatttatggcactatcctatc
attatttttatgaatagttatttcgtacaaggtcagattccttggtttgtatatatttgt
gaagtgatacttatgtttgtcatggctgaagtatcttataaatttatcgaaacacctatt
agaaaaaatggatttaaagcattcacggtgataccgaaaaatttaacaagattttcaaga
acgattattgtgttaatcttgcttgttccttctgcattcatagtatttggtgcctatgat
agtttgggtaaagagcatgataaacaacaagctgcgaaacaaaaatcttttaaaacgaac
cagaaagcaaaacctaaaaagccagatgaaaataatcaagataagtcttcacaacaacat
tttaatcctaaagaagcgtctccattattgctgggagattcagtaatggtagatatcggt
caagtctttagtgaaaaagtaccaaatgctaatattgatggaaaagttggccgacagtta
attgagggtaaagatttaatcaatcaaaagtaccaagattatactaaaaaaggtcagagt
gttgtgatagaacttggtacaaacggtgagtttacgaaagatcaaatgaatgaattaatt
gattctttaggtgaagcagatatttacttaattaaggtaagagtaccgagagactacgag
tctactaataataaaattatggaacaagtagctaagaaacataaaaatgttcatattgtt
gattggtataaaacatctgaaggtcattctgagtattttgcatatgatggtattcacttg
gaatacagtggtgttaaggcattatctaatgaaatcattaagaaaatgaaagaagttaat
gaaaaataa

DBGET integrated database retrieval system