KEGG   Staphylococcus epidermidis RP62A: SERP2138Help
Entry
SERP2138          CDS       T00229                                 

Definition
(GenBank) immunodominant antigen A, putative
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglycosylas SLT
Motif
Other DBs
NCBI-ProteinID: AAW53038
UniProt: Q5HL49
Position
complement(2164774..2165481)
Genome map
AA seq 235 aa AA seqDB search
MKKTVIASTLAVSLGIAGYGLSGHEAHASETTNVDKAHLVDLAQHNPEELNAKPVQAGAY
DIHFVDNGYQYNFTSNGSEWSWSYAVAGSDADYTESSSNQEVSANTQSSNTNVQAVSAPT
SSESRSYSTSTTSYSAPSHNYSSHSSSVRLSNGNTAGSVGSYAAAQMAARTGVSASTWEH
IIARESNGQLHARNASGAAGLFQTMPGWGSTGSVNDQINAAYKAYKAQGLSAWGM
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacagttatcgcttctacattagcagtatctttaggaattgcaggttacggt
ttatcaggacatgaagcacacgcttcagaaactacaaacgttgataaagcacacttagta
gatttagcacaacataatcctgaagaattaaatgctaaaccagttcaagctggtgcttac
gatattcatttcgtagacaatggataccaatacaacttcacttcaaatggttctgaatgg
tcatggagctacgctgtagctggttcagatgctgattacacagaatcatcatcaaaccaa
gaagtaagtgcaaatacacaatctagtaacacaaatgtacaagctgtttcagctccaact
tcttcagaaagtcgtagctacagcacatcaactacttcatactcagcaccaagccataac
tacagctctcacagtagttcagtaagattatcaaatggtaatactgctggttctgtaggt
tcatatgctgctgctcaaatggctgcacgtactggtgtatctgcttcaacatgggaacac
atcattgctagagaatcaaatggtcaattacatgcacgtaatgcttcaggtgctgctgga
ttattccaaactatgccaggttggggttcaactggttcagtaaatgatcaaatcaatgcc
gcttataaagcatataaagcacaaggtttatctgcttggggtatgtaa

DBGET integrated database retrieval system