KEGG   Staphylococcus epidermidis RP62A: SERP2140Help
Entry
SERP2140          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2166137..2167561)
Genome map
AA seq 474 aa AA seqDB search
MSGKLEELQLKVARLSRRTHELGIPIMVLFEGIPASGKTRLSNELLLHLDAKYSRFIATK
SPESNDLRYQFLQKYWNTLPQKGNINIYFRSWYSHFLDYKENKIKHDQYKNYDVLVNQIY
HFESMLKNDNYEIIKFFIEINEEKRNEHIQQTKDNPLTRWKVQEYENVIPQESYLNQMHQ
FINKDKDWKVIDYTEREHAFEKMYLHLIDRLEQAIKKVEQQTTKVNGKFTSSFTTSLFNN
NLEKVDKKTYKNLIVELQQRMREIQFALYERKIPLVLVFEGMDAAGKGGNIKRIREKLDP
TGYEVNGISAPTDVELKHHYLWRFAKKMPKSGHIEIFDRSWYGRVLVERVEGFASQNEWQ
RASDEINQFEKMWTDEGTIILKFFLCLDKDEQLKRFKDRENNPDKQWKITEEDWRNREKW
DKYLEASHDMIESTNTSYAPWYIVLADHKKTSRIEVLKTIIRKCEEVLWGVKTY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggaaactagaagaattacaattaaaagtagctcgattaagtcgacgtactcat
gaattaggtattccaattatggtattatttgaggggattcctgcttcggggaagacacgt
ttatcaaatgaattactattgcacctagatgccaaatattcgcgatttatagctactaaa
tcgccagagtcaaacgatttacgttaccaatttttacaaaaatattggaatactttacca
caaaagggcaatataaatatttattttagaagttggtattcacactttttagattataaa
gaaaataaaattaagcatgatcaatataaaaattatgatgttttagtcaatcaaatttat
cattttgaatcgatgttaaagaatgataactatgaaattataaaatttttcatagaaata
aatgaagaaaaacgcaatgaacatattcaacagacaaaagataatccattaactagatgg
aaagttcaagaatatgaaaatgttatacctcaagaaagttatctaaatcaaatgcatcaa
ttcatcaacaaagataaagattggaaagtgatcgattacacagagcgcgagcatgctttt
gaaaaaatgtacttacatttaatagatagacttgagcaagctataaaaaaagttgaacaa
caaacaactaaagtcaacggtaagttcacatcaagctttacgacttctttatttaataat
aatcttgagaaagtagacaaaaaaacgtataaaaatctcattgttgaattgcaacagaga
atgagagaaatccaatttgctttatatgaaagaaagattccccttgttttggttttcgaa
ggtatggatgctgctggtaaaggtggcaatattaaacgtattagagaaaaattagatcca
acaggatatgaagtgaatggtattagtgcacctacggatgtcgaacttaagcatcattat
ttgtggagatttgctaaaaagatgccaaaatcaggtcatatagaaatatttgatcggagt
tggtatggtcgtgtactagttgaacgtgtagaaggttttgcaagccagaatgaatggcaa
cgagcatctgatgaaatcaatcaatttgaaaagatgtggacagatgaaggtacaatcata
ttaaaattcttcttatgtttagataaagatgagcagcttaagcgttttaaagaccgtgaa
aataatcctgataaacaatggaagattactgaagaagattggcgtaatagagaaaaatgg
gataaatatttagaagcaagtcatgatatgattgaatctacaaacacttcatatgcccct
tggtatattgttctggcagatcataaaaaaacgagtcggattgaagtacttaaaacaatt
attagaaaatgtgaagaagtactatggggagttaagacgtattaa

DBGET integrated database retrieval system