KEGG   Staphylococcus epidermidis RP62A: SERP2144Help
Entry
SERP2144          CDS       T00229                                 

Gene name
pyrD
Definition
(GenBank) dihydroorotate dehydrogenase
  KO
K00226  
dihydroorotate dehydrogenase (fumarate) [EC:1.3.98.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SERP2144 (pyrD)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.1  dihydroorotate dehydrogenase (fumarate)
     SERP2144 (pyrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2171689..2172753
Genome map
AA seq 354 aa AA seqDB search
MYKLVKPLLFKLDPERAHGLTINALKCVQKCSPILPIVNKLFTYNNPILTQHIHGISFDN
PIGLAAGFDKSCEVPKALENIGFGAIELGGITPKPQPGNPKPRMYRLLEDDALINRMGFN
NKGMNKALSNLRNHSCSIPVGLNVGVNKTTSYENRYQDYIKVIDTFKNDVSFFTVNISSP
NTENLQNFHDEDEFSMLCDALNSFKAKNNINVPIFLKLTSDMELDGFKKILPSITDTFDG
VMLANTTRQRDGLNSKNKIQEGGLSGRPLFQRNLQLVKYAYQQTRGNFLIIGTGGIFSSE
DAIKMLRNGASLLQIYSSLVIEGPGLTKKMNKEIAHYLTRHGYANVSDIIGLDA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaattagttaagcctttattattcaaattagatcctgaacgagcacatggtttg
accatcaatgcgttgaagtgtgttcaaaaatgttcacccattttacctatcgttaataag
ttatttacttataacaatccaatattaacgcaacacattcacggtatttcttttgataat
cctatcgggttagctgcaggttttgataaatcttgtgaagttccaaaagcacttgaaaac
attggcttcggtgcaattgaactcggcggtataacacctaagcctcaaccaggtaatcca
aaaccacgcatgtatcgtttactagaagatgatgcactcatcaatcgtatgggattcaat
aataagggtatgaataaagcactaagtaatttacgtaatcattcatgctcaataccagta
ggattaaatgttggtgtgaataaaacaacttcctatgaaaatcgctatcaagattacatt
aaagtgattgacacatttaaaaatgacgtctcattctttacagtgaatattagctcccca
aatacagaaaatctccaaaactttcacgacgaagatgaattttcgatgttatgtgatgct
ttaaattcatttaaagctaagaacaatattaatgtacctatctttttaaagttaacatct
gatatggaattagatggttttaaaaaaatcttgccttcaattacagatacattcgatggg
gttatgttggcaaatacgacacgacaacgcgatggattaaattcaaaaaataaaatacaa
gaaggtggtttgagtggcagaccattattccaaagaaacttacaactggttaaatatgcc
tatcaacaaacacgaggtaacttcttaattattggaactggtggtatattcagttctgaa
gatgctatcaaaatgttaagaaacggtgcatcattactacaaatatactcttcattagtc
attgaaggaccaggtttgactaagaaaatgaataaagaaatcgcgcattatttaactcga
catggttatgctaatgtaagtgatattattggtttagatgcataa

DBGET integrated database retrieval system