KEGG   Staphylococcus epidermidis RP62A: SERP2147Help
Entry
SERP2147          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09765  
epoxyqueuosine reductase [EC:1.17.99.6]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.6  epoxyqueuosine reductase
     SERP2147
Transfer RNA biogenesis [BR:ser03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    SERP2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2173685..2174401)
Genome map
AA seq 238 aa AA seqDB search
MIEANQILAKMKNQKINYDKVLRKIISQWERDGERPKILLHSCCAPCSTYTLEFLTQYAD
IAIYFANPNIHPKSEYLRRAKVQEQFVNDFNNKTGANVKYIEAEYEPHKFMKMAKDKGLT
EEPEGGLRCTACFEMRLEIVAKAALEHGYDYFGSAITLSPKKNAQLINELGMDVQNIYNV
KYLPSDFKKNKGYERSIEMCNDYNIFRQCYCGCVFAAMKQGIDFKQINKDAQAFLQQF
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaagcgaatcaaattttagctaaaatgaaaaatcaaaaaatcaactatgataaa
gtattaagaaagataatttctcaatgggaacgtgatggagaacgccctaaaatcttactt
catagttgttgtgcaccttgtagtacatatacgttagagtttttaacacaatatgcggat
atagcgatttattttgcgaatcctaatatacatcccaaaagtgaatatttaagacgtgct
aaagttcaagaacaatttgtaaatgattttaataataaaacaggtgcaaatgtaaagtat
attgaagccgaatatgaaccgcataaatttatgaaaatggcaaaagataaaggtttaact
gaagagccggaaggtggactaagatgtacggcttgtttcgagatgcgattagaaattgtt
gcaaaagctgctttagaacatggttacgattattttggtagtgcaatcacactctctcca
aagaaaaatgcgcaattaatcaatgaactaggtatggatgtacaaaatatatataatgta
aaatatttaccaagtgattttaaaaagaataaagggtatgaacgttctatcgaaatgtgt
aatgattataatatttttagacaatgttattgtggctgtgtatttgcagcgatgaagcaa
ggtatagattttaaacaaataaataaagatgctcaagcatttttacaacaattttaa

DBGET integrated database retrieval system