KEGG   Staphylococcus epidermidis RP62A: SERP2148Help
Entry
SERP2148          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-ribbon_3 zinc_ribbon_2 DZR Nudix_N_2 SMP_2 Prok-RING_1 ABC2_membrane_3 U3_assoc_6 VirB8 DUF4307 DUF2116 DUF4446 CwsA FAM209 Peptidase_S49_N zf-NADH-PPase TPPK_C MFS_2 SID-1_RNA_chan
Motif
Other DBs
NCBI-ProteinID: AAW53063
UniProt: Q5HL39
Position
complement(2174678..2176009)
Genome map
AA seq 443 aa AA seqDB search
MKYCSNCGQPLREGVKVCTNCGTPVRNDGPNYKHSEQRYSHQQPRSNKSNKKTWLIVTIV
LAIIIALVVIFTIAKNQMSPEKQATHIAHAIKKDDAKSLSKQLTSNDHRLNEEEARAYLK
YIKAESDLKHVADKVEENTKDIKNNHYNNLSVDANDNNILNISKDGKKYVFFDNYQFNVP
QKTITLVSSDSGEITYEFNGDKHHISVEEDDDKELGTFPIGDYNLKASKDMEGKNFKGAI
TIDMSESDSIAYESFKQKRFNVDTEGGYILDNVKIYANGKEIGDGFSSETYGPYDPDEEV
IVHAEGSYEGKTFKSNSVNVASASEKDGGVTDVTVKFDEEAIDQYVDKKLDEKYDDSDDE
SDNDSSSGEVTRENVIDKVESYEGHTLDTDTYTYKEPEKTGDGKWGFSFLDKDGDLAGSY
TVDIDDGYVTEYDEDGEEVGSGY
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattgcagtaattgtggtcaacctcttcgagaaggtgtaaaggtgtgtacaaat
tgtggtacgcctgtgagaaatgatggacctaattataaacattcagaacaacgttattct
catcaacaaccacgttccaataagagtaataaaaaaacttggttgattgttactatagtg
ttagccattatcattgctttggtagtaatctttactatagctaaaaatcaaatgtctcca
gaaaaacaagcgactcacattgcacatgctatcaaaaaagacgatgctaaatcattatct
aagcaattaacatcaaacgatcatcgtttaaatgaagaagaagcacgtgcgtacttaaag
tatattaaagcagaaagtgatttaaagcatgttgctgacaaagttgaagaaaacaccaaa
gatattaaaaataatcactataacaatttatctgtagatgcaaatgataataatatttta
aatatatctaaagacgggaaaaaatatgttttttttgataactatcaatttaatgttcct
caaaaaacaattacgctcgtttcaagtgatagtggtgaaattacttatgaatttaacggg
gataaacatcatatttctgtagaagaagatgacgataaagaattaggaacatttcctatc
ggtgattataatttaaaagcatcaaaagacatggaaggtaaaaattttaaaggcgctatt
acaattgatatgagtgaaagtgatagtattgcatatgaatcgtttaaacaaaaacgtttt
aatgttgatactgaaggcggatatatattagataatgtaaaaatatatgctaatggtaaa
gaaataggcgatggtttttcatcagaaacatatggtccttatgatccagatgaagaagtt
atcgttcacgctgaaggttcatacgaaggaaaaacttttaaatcaaattcggtcaatgta
gcaagtgcaagcgaaaaagatggtggtgtgacagatgtcacagtcaaattcgatgaagaa
gctattgatcagtatgtcgataaaaaattagatgaaaaatacgatgattcagatgacgag
tcagataacgattcaagtagtggcgaagtaacgcgtgaaaatgtaattgataaagtagag
tcatatgaaggacatacactagatactgatacgtatacgtataaagaacctgaaaaaacc
ggtgatggtaaatggggtttttcattcttagataaagatggagatttagctggatcgtac
acggtagacattgacgacggttatgttacagaatatgacgaagatggtgaagaagttgga
tctggttattaa

DBGET integrated database retrieval system