KEGG   Staphylococcus epidermidis RP62A: SERP2160Help
Entry
SERP2160          CDS       T00229                                 

Definition
(GenBank) conserved domain protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2189763..2190194
Genome map
AA seq 143 aa AA seqDB search
MHWLKIFYHLLCATTISVILLIITILMDALLQNTHLTQLLLNIDFLINPDEVPTIIEVLI
HLSIGILIYLAFLIIYHYSKSLYHLAYLPLVLIFTLMYPLLVFLAQRPFFSFSWNEFAWW
LVAHLFFIILMATCLPIISKKIL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgcattggttaaaaatattttatcatttattatgcgcaaccacgattagcgtgatatta
cttattataactatattaatggatgcgttactacaaaacacacacttaactcagttatta
ctcaatattgattttttaatcaaccctgatgaagtgccaacaattattgaagtactgatt
catttaagtattggaatattgatttatctcgcctttttaattatctatcattattcaaaa
tccttgtatcatctcgcatacttacctttagtattgatatttactttgatgtatccactt
ctcgtttttcttgcgcaacgtccatttttttcctttagttggaacgaatttgcatggtgg
ttagttgcacatctttttttcatcattttaatggcgacttgtttacctatcatttcgaaa
aaaattttatga

DBGET integrated database retrieval system