KEGG   Staphylococcus epidermidis RP62A: SERP2175Help
Entry
SERP2175          CDS       T00229                                 

Definition
(GenBank) amidohydrolase family protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AAW52968
UniProt: Q5HL12
Position
complement(2205477..2206652)
Genome map
AA seq 391 aa AA seqDB search
MNQTLVQHLREKEQRMKEIRRYLHENPELSFEENETSKYIANFYKDKDCLVETNVGPNGI
KVTIAGKHPGKTIAIRADFDALPIKEETELPYASKNEGVMHACGHDAHTAYMLILGETLI
EMKDQLRGNVVIIHQPAEEMPPGGAKGMIDDGVLEGVDHVLGAHVMSMMETGKIYYREGF
VQTGRAYFRLVVKGQGGHGSSPHTSNDAIVAGAHFVTTAQTIVSRRLNPFETGVVTIGSF
DGKGQFNVIKDTITIEGDVRALTDDTRDNIQNEMTRLVRGLEEMFGVICDFEFKKDYPAL
YNDPEFTSYVATTLKNAKLDDIKAIDICEPQPPSEDFAFYALERPSTFIYSGAAPEDGPM
YPHHHPKFNINETSMLVVAEAVGTIVLDYLK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaactttagttcaacatctacgtgaaaaagagcaaagaatgaaagaaataaga
cgttacttacatgaaaatcctgaattatcattcgaagaaaatgaaacatctaaatatatt
gcaaacttttataaagataaggattgtttagttgagacgaatgtgggtcctaatggaatt
aaagttaccatcgcaggtaaacatccaggaaaaactatcgctattcgtgctgactttgat
gcgctaccgataaaagaagaaacagaattaccttatgcttctaaaaatgagggagtcatg
catgcttgtggtcatgatgcacatactgcgtacatgctaatacttggagaaacattaatt
gaaatgaaagatcaattgagaggtaatgtcgtgattatacatcaacctgcagaagaaatg
ccaccgggcggtgcgaaaggtatgatagatgacggcgtattagaaggggtggaccatgtt
ttaggtgcacatgtgatgagtatgatggaaacaggtaaaatatactatcgtgaaggtttt
gttcaaacgggacgcgcttattttagacttgttgtgaaaggtcagggtggtcacggctca
tccccacatacatcgaatgacgctattgtagcaggtgcgcattttgtaacgaccgcacag
accattgtttcaagacgcttaaatccgtttgaaacgggtgtagtcacaataggttccttc
gacgggaaaggacaattcaatgtgattaaagatacaataacaatcgaaggtgatgtacgt
gcactgactgatgatacaagagacaatattcagaatgaaatgacacgactagtcagagga
ttagaagagatgttcggagtgatttgtgattttgaatttaaaaaggattatccagctctt
tacaatgatcctgaatttacttcttatgtagcaacaactttaaaaaatgctaagctggat
gacataaaagcaatagatatttgtgagccgcagccaccctcagaagatttcgcgttttat
gcgttagaaagaccttcaacatttatttattcgggtgcagcaccagaagatggacctatg
taccctcaccatcatcctaagtttaatatcaatgaaacatctatgcttgtagttgcagag
gcagtgggtacaattgtattagattatttgaaataa

DBGET integrated database retrieval system