KEGG   Staphylococcus epidermidis RP62A: SERP2180Help
Entry
SERP2180          CDS       T00229                                 

Definition
(GenBank) anaerobic C4-dicarboxylate membrane transporter
  KO
K07791  anaerobic C4-dicarboxylate transporter DcuA
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Transporters [BR:ser02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SERP2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcuA_DcuB
Motif
Other DBs
NCBI-ProteinID: AAW52983
UniProt: Q5HL07
Position
complement(2213467..2214765)
Genome map
AA seq 432 aa AA seqDB search
MLLFIIEIIIMILAILLGLRTAGALGCGIFAIVAQLIMIFGFQLPPGSAPVTAVLIILSI
GIAGGTLQATGGIDYLVYIASRVIERFPKSIIFIAPMIVFVFVFGIGTANIALSLEPIIA
KTAQKARIQPKRALTASVLTANLALLCSPAASATAYIISVLAGYEISMGKYLSIVLPTAL
ISMLMLSTFCTFVGRKEHVRDESERLVQMPEVEIKNDFSLKVKIGVISFLLCVMGILTFG
IFPNLMPQFNVNGDVVKVEMTEIVQFFMYLSATINLLLIKINTSDILSSNITQSAMGALF
AVLGPGWLGATIFNAPHNLKILKNDIGSIISEVPWLVIILVSVVAMIVISQTATASIMVP
IVMSLGIPPIYFVAMVQTLNVNFVIPAQPTLLFAVELDETGRTRPTSFMIPGFFVITVSV
ITGFVIKTILGY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttattgtttatcatagaaatcataatcatgattctagcgatattattaggattaaga
actgctggtgcactgggatgtggcatctttgctatagtagcgcagcttatcatgatattt
ggattccagttacctccaggttcagcaccagtgacggcagtgttaatcatattatctatt
ggtatagcaggtggtacgttacaagccactggtggtattgactatttagtatacattgca
tcacgtgtgattgaacgctttccaaaatcaattatatttatagcgccaatgattgtcttt
gtctttgtttttggaattggtactgcaaatatagctctttcacttgaacctatcatagcg
aaaactgcacaaaaagcacgaattcagcctaaacgcgcattaactgcttcggtacttaca
gccaatttagccttactttgtagcccggcagcttctgctacagcttatattatttctgta
ttagcagggtatgaaatatcgatgggcaagtatttaagtattgttttacctacagcttta
attagtatgttaatgcttagtacattttgtacatttgtaggacgaaaagaacacgtgcgt
gatgagtcagaacgtttagttcagatgccagaagtcgaaatcaaaaatgacttttcatta
aaagtaaaaataggtgttatctcattcctattatgtgtcatgggtattttaacgtttggc
atatttcctaatctcatgccgcaattcaatgtgaatggagatgtagttaaagttgagatg
actgaaattgttcagttctttatgtatctcagcgctacaatcaatttattattaataaaa
atcaatacttctgatattctgtcatcgaatattacacaatctgcaatgggagcacttttt
gcagttcttggcccaggttggttaggtgcaacaatatttaatgctccacataacttaaaa
atattgaaaaatgatattgggtcaattattagtgaagtaccttggcttgttatcatactt
gtttctgtagttgcaatgattgtcatttctcaaacagctacagcatcaattatggtgccg
atagttatgagtttaggtatacctcccatctattttgttgcgatggtacaaacattaaat
gtgaatttcgttattccagctcaaccgacactattatttgctgtagaactagatgaaaca
ggtagaacaagacctacgagctttatgataccaggattttttgttataacagtatccgtc
attacaggatttgttattaaaaccattttaggatattaa

DBGET integrated database retrieval system