KEGG   Staphylococcus epidermidis RP62A: SERP2184Help
Entry
SERP2184          CDS       T00229                                 

Definition
(GenBank) hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2217830..2218135)
Genome map
AA seq 101 aa AA seqDB search
MSFNIWMWILLVLFIVGTIAVILILTVGSVLEERSYDRRSEDEKRKNLEKNLEMSKGHTD
VSQESSNGEEQVTQEHSQHVVQDHQQTHQNINQSTQDNRNN
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaatatttggatgtggattttacttgtattatttattgtggggacaatagct
gtaattctcattttaacagttggctcagtgttagaagagcgctcatatgaccgtcgatca
gaagatgaaaagcgcaaaaatttagaaaaaaatcttgagatgtcaaagggacatacagat
gtatcgcaagagtcgagcaatggggaagaacaagtaacacaagagcattctcaacatgtc
gttcaagatcatcaacaaacacatcaaaatataaatcaatcaacacaagataatagaaat
aattag

DBGET integrated database retrieval system