KEGG   Staphylococcus epidermidis RP62A: SERP2189Help
Entry
SERP2189          CDS       T00229                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase, putative
  KO
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SERP2189
Enzymes [BR:ser01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     SERP2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2221883..2222662)
Genome map
AA seq 259 aa AA seqDB search
MGKVYLVGAGPGDPELITLKGLKAIKEADVILYDRLVNKEILNYASLSTKFFYCGKDPHR
HSLPQEETNKMMVTLAKKGHIVTRLKGGDPFVFGRGGEEAEELACHNIHFEIIPGITSGI
AAPAYAGIPVTHRDYSSSVAFVTAVNKPGMDKGKYWQHLANGPETLCIYMGVKRLSEICE
LLIQYGRSSETPVALVHMGTSKQQMTVTGTLDTIQERAHHIQNPAMIIVGEVVKMREKIN
WFVEQATVQNETLTEMSST
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtatatttagttggagctggacctggtgatccagaattaataacgttaaaa
ggtttaaaagccattaaagaagccgatgtcatcctttatgaccgacttgtaaataaagaa
atacttaattatgcttctctttctactaagttcttctattgcggtaaggatcctcacagg
cactccttaccgcaggaagaaacaaataaaatgatggtaaccttagccaaaaaagggcac
atagttacacgtttaaagggtggcgatccatttgtttttggacgtggcggagaagaagca
gaggaattagcatgtcataatatccactttgaaattatacctggaattacatcgggaatt
gcagcaccagcatatgctggaattccagtaacacatcgtgattatagttcttctgtagca
tttgtaactgcagtgaataaacctggtatggataaaggcaaatactggcaacatttggcc
aatggtcctgaaactttatgtatttatatgggggttaagagactcagtgaaatttgtgag
ttgttaatacaatatggtcgttcgtcagaaacaccagtagctctcgtgcatatgggaacg
tcaaaacagcaaatgacagtgactgggacactcgatacaattcaagaacgagcacatcat
attcagaatccagcaatgattattgtaggcgaagtggttaagatgagagaaaaaattaat
tggtttgtagaacaggcaactgttcaaaatgaaacgttaacggaaatgtcatcaacttag

DBGET integrated database retrieval system