KEGG   Staphylococcus epidermidis RP62A: SERP2194Help
Entry
SERP2194          CDS       T00229                                 

Gene name
gpxA-2
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SERP2194 (gpxA-2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SERP2194 (gpxA-2)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SERP2194 (gpxA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2227609..2228085)
Genome map
AA seq 158 aa AA seqDB search
MSIYDIAVENYDGSTYLLKRYKGKVLIIVNTATNCTLNDQFNKLEMLYKKYHKYGLEILS
FPCNDFNNQEPGLIKDIYRVYKYKFGITFPIHAKINVNGEHEHPLYTLLKCKQPGLFGSQ
IKWNFTKFVVDQQGNIVKRFLPCDNPNQMEKLIRQLLK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttatgatattgcggtagagaattatgatggctctacctatttactaaaaaga
tataaagggaaagtgctcattatcgtaaatactgcaacgaattgtactctgaatgatcaa
tttaataaattagaaatgctttataaaaaatatcataagtatggtcttgaaattttgagc
ttcccttgcaatgattttaataatcaggagccaggattaatcaaagatatttatcgagta
tataaatataagtttggtattactttccccatccatgctaagattaatgttaatggagag
catgaacaccctttgtacacattattaaaatgtaaacaaccaggattatttggttcgcaa
attaagtggaattttactaaatttgtagtagatcaacagggaaatattgttaaacgattt
ttaccttgtgataatcctaaccaaatggaaaaattaataagacaattattaaaataa

DBGET integrated database retrieval system