KEGG   Staphylococcus epidermidis RP62A: SERP2201Help
Entry
SERP2201          CDS       T00229                                 

Definition
(GenBank) sodium:solute symporter family protein
  KO
K03307  solute:Na+ symporter, SSS family
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-ProteinID: AAW53026
UniProt: Q5HKY6
Position
complement(2234763..2236355)
Genome map
AA seq 530 aa AA seqDB search
MNWISIILFIMVVGGISFYAYLQSRKIKTSSSDGYFMGGNSLTGFTVASTIIMTNLSTEQ
IVGQNGQSYAQGMEVMAWEVTAAVAVVLLAWVFLPKYLKYGVNTISEFLELRYDTFTKRF
VSILFIFTYVVSFLPVVLYSGSLVFNKMFKVDEYLDVSSSTAVIIISSIIGIIGIIYLFI
GGLSLSAFSDSIYGMSLIIGGLAITILGLGQLGDGNFLHGFDKIVQDTPEKLNGFGKVDS
DVVPWPTLFFGMFFNNLFFWCANQMIVQKALAAKNLKESQKGAIYLSLFKVFGPLITVLP
GVVAFNYFNGSIDKSDNAYPALVTSVLPEWAFGLFGAVIFGAILSSFVGSLNSTTTLLTL
DFYKPIFGKNKSDKHIARVGHIATVVIGVIVVALAPVISLFPSGLYAVVQQFNGVYSMPV
LALILVAFFSKRTSKLGAKVTLFTHIILYAIISFVFTEINYLYTFSVLFFVDLIIILIFN
KVKPSSEFDLSTHQPKVDMTPWKYRYVAGIIVLALVVVSYIIFSPLVLAK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaattggatatcgattattttatttattatggtcgtaggtggcatttctttttatgcc
tatttgcaatcaagaaaaattaaaacgagtagttcagatggttattttatgggaggaaat
agccttactggatttacagttgcctctacaattatcatgaccaatttgtcgacagaacaa
attgttgggcaaaatggtcaaagctatgcacaaggaatggaagtaatggcttgggaggtt
acggctgccgtagcagttgtattgttggcttgggtctttcttcctaaatatctaaaatac
ggtgttaatacaatttctgagtttttggaattacgttatgatacatttactaaacgtttt
gtctccattttatttatctttacctatgtcgtatctttcttgcctgtagtattgtactct
ggttccctagtgttcaataaaatgtttaaagttgatgaatacttagatgtaagtagttca
actgctgtcatcattatttcatctattattggtataattggcattatttacttatttata
ggtggtttatcgttaagtgcttttagtgattcaatttatggcatgtctttaatcataggt
ggacttgcgattacaatattaggtctaggtcaattaggagatggcaacttcctacatggc
ttcgacaaaatcgtgcaagacacacctgagaaattgaatggttttggtaaggtggactcg
gatgttgtaccttggccaaccctattcttcggtatgttctttaacaatttattcttctgg
tgcgcaaaccagatgatagttcaaaaagcactcgcagctaaaaatttaaaagaatctcaa
aaaggtgcaatatatttaagcttatttaaagttttcggaccattaattacagtcttacca
ggtgtagtagcatttaactattttaatggtagtattgacaaatcagataacgcttaccct
gcacttgtaacttcagtattaccagaatgggcatttggcttatttggtgcggttattttt
ggtgcaatattgagctcatttgttggctcattgaatagtacaactacactattgacactc
gatttctataaacctatttttggaaaaaataaatcagataaacatattgctcgagtaggc
catattgctactgtagtcattggagttattgttgtagcacttgcaccagtcatctcatta
ttccctagtggtctttatgcagtagttcaacagtttaatggtgtgtatagtatgccagtg
ctagctttgattttagtggctttcttttctaaacgcacatctaaattgggcgctaaagtg
acactcttcacacatataattttatacgctatcatcagctttgtatttacagaaattaat
tacctatacacatttagtgtattattctttgtagatttaattattattttgatctttaac
aaagttaaaccatctagtgagtttgatttaagcacgcaccaaccgaaagtagatatgacg
ccatggaaatatcgttacgttgcaggtattattgttcttgcattagtagtagtaagttat
attatcttctcaccactcgtgttagcaaaataa

DBGET integrated database retrieval system